Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A120E8D4

Protein Details
Accession A0A120E8D4    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-29QSKNHTNHNQNKKAHRNGIKKPKTQRYPSHydrophilic
NLS Segment(s)
PositionSequence
12-28KKAHRNGIKKPKTQRYP
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences QSKNHTNHNQNKKAHRNGIKKPKTQRYPSMRGVDPKFRRNARYAAQGTQKAIAAAKKEAAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.82
5 0.85
6 0.84
7 0.82
8 0.83
9 0.83
10 0.82
11 0.79
12 0.79
13 0.77
14 0.75
15 0.75
16 0.71
17 0.62
18 0.6
19 0.57
20 0.57
21 0.53
22 0.51
23 0.51
24 0.49
25 0.5
26 0.47
27 0.49
28 0.44
29 0.49
30 0.46
31 0.45
32 0.49
33 0.48
34 0.45
35 0.41
36 0.37
37 0.28
38 0.28
39 0.24
40 0.2
41 0.2
42 0.2
43 0.2