Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A120E9D9

Protein Details
Accession A0A120E9D9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
167-187ASQRARSRSRRHDRTAREFGKBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR009030  Growth_fac_rcpt_cys_sf  
IPR038955  PriA/CPL1_fungi  
Amino Acid Sequences MLFARAAAVLPLLAATASAQLIKIPFLNIGLLQPGALVTADAIINLFDPGAGCGQDATVGVKTNLLGLVRVCACVNALAIDPIITIGGSEQACPACSDPNASPSCGSGKCICVCNSGFYADGATGKCLPVNSCPSPNTLTSNGDGTFTCNCVAPYVVNSNGVCALGASQRARSRSRRHDRTAREFGKRSQVAGQQVYAPAPSEESHVSCPEGETACPLASGGFECVDTTNSLTACGGCPGPYGPGQDCLAIPGALNVQCADSKCIVGSCFRGWRFDASGNGRCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.06
6 0.07
7 0.08
8 0.09
9 0.1
10 0.11
11 0.1
12 0.1
13 0.11
14 0.12
15 0.11
16 0.11
17 0.12
18 0.11
19 0.09
20 0.09
21 0.08
22 0.07
23 0.07
24 0.05
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.06
38 0.07
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.09
45 0.09
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.12
52 0.1
53 0.09
54 0.08
55 0.12
56 0.12
57 0.13
58 0.12
59 0.11
60 0.11
61 0.11
62 0.11
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.04
72 0.03
73 0.03
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.1
80 0.11
81 0.11
82 0.09
83 0.1
84 0.13
85 0.12
86 0.19
87 0.2
88 0.2
89 0.19
90 0.18
91 0.22
92 0.19
93 0.21
94 0.16
95 0.18
96 0.2
97 0.23
98 0.23
99 0.22
100 0.23
101 0.23
102 0.22
103 0.19
104 0.17
105 0.14
106 0.13
107 0.1
108 0.11
109 0.09
110 0.09
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.11
117 0.18
118 0.18
119 0.21
120 0.21
121 0.23
122 0.25
123 0.25
124 0.25
125 0.2
126 0.2
127 0.18
128 0.19
129 0.17
130 0.15
131 0.14
132 0.13
133 0.11
134 0.11
135 0.1
136 0.09
137 0.09
138 0.08
139 0.09
140 0.07
141 0.08
142 0.1
143 0.1
144 0.13
145 0.12
146 0.12
147 0.12
148 0.12
149 0.1
150 0.07
151 0.07
152 0.06
153 0.09
154 0.09
155 0.13
156 0.16
157 0.19
158 0.24
159 0.31
160 0.39
161 0.47
162 0.58
163 0.63
164 0.68
165 0.74
166 0.78
167 0.81
168 0.83
169 0.77
170 0.74
171 0.68
172 0.63
173 0.63
174 0.55
175 0.47
176 0.42
177 0.41
178 0.38
179 0.36
180 0.34
181 0.25
182 0.26
183 0.24
184 0.19
185 0.15
186 0.1
187 0.1
188 0.09
189 0.11
190 0.11
191 0.13
192 0.15
193 0.15
194 0.16
195 0.15
196 0.15
197 0.15
198 0.15
199 0.13
200 0.13
201 0.14
202 0.13
203 0.13
204 0.12
205 0.09
206 0.09
207 0.1
208 0.08
209 0.07
210 0.07
211 0.08
212 0.08
213 0.09
214 0.1
215 0.1
216 0.11
217 0.11
218 0.11
219 0.11
220 0.11
221 0.11
222 0.12
223 0.11
224 0.09
225 0.1
226 0.1
227 0.12
228 0.14
229 0.17
230 0.17
231 0.21
232 0.21
233 0.22
234 0.21
235 0.2
236 0.19
237 0.15
238 0.14
239 0.11
240 0.14
241 0.14
242 0.14
243 0.13
244 0.13
245 0.15
246 0.17
247 0.2
248 0.17
249 0.17
250 0.17
251 0.19
252 0.18
253 0.2
254 0.22
255 0.24
256 0.31
257 0.32
258 0.34
259 0.35
260 0.39
261 0.4
262 0.4
263 0.43
264 0.43