Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A125PJ85

Protein Details
Accession A0A125PJ85   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
417-441DESLARFKSEKRERLKIKRLSWGPVHydrophilic
NLS Segment(s)
PositionSequence
427-432KRERLK
Subcellular Location(s) nucl 14, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036514  SGNH_hydro_sf  
Amino Acid Sequences MTSELGLSYDASSVRSAPVHSARPTSALGQHPAPVWRPSSVSLRSTHSLPLSTPPTHTRLSRPVLQLTTPPATPSRRENSAARGASLERTPGASISLVRRTPSLTRRPPSPASSPSTTSTPSPTLYRPPHARLSTSPSSTGNLSWTNTSRSPSPTLSRPRPQQQQPLLEVHGDSFCGVFTLLGSKCAVKRYSGASARGLSNPQSSRQVSSRLLDRLETARPRSVLLMFGAVDFAINYLWQLKARGAEAVGPDEWVKKVITDYATFLSARIVPLARKLGMRIYISGVLPPVIEDCYLEAVADKYISKNSTTVDLLPLVETAHPHDLATRTTMIRRYNSMLASYCRQCADCLTFVDIGRDLVDMRDPLYRVASDFRDPQDVTNIHLLWETTLPFWMRALPPLAPFAPQMASAPALSRLDESLARFKSEKRERLKIKRLSWGPVGVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.2
5 0.26
6 0.32
7 0.34
8 0.37
9 0.36
10 0.38
11 0.39
12 0.36
13 0.36
14 0.34
15 0.35
16 0.32
17 0.34
18 0.33
19 0.35
20 0.35
21 0.32
22 0.29
23 0.27
24 0.28
25 0.29
26 0.34
27 0.36
28 0.36
29 0.35
30 0.39
31 0.4
32 0.39
33 0.4
34 0.34
35 0.3
36 0.28
37 0.32
38 0.31
39 0.3
40 0.32
41 0.32
42 0.34
43 0.37
44 0.38
45 0.37
46 0.4
47 0.45
48 0.49
49 0.49
50 0.51
51 0.5
52 0.48
53 0.45
54 0.42
55 0.39
56 0.32
57 0.29
58 0.28
59 0.3
60 0.32
61 0.36
62 0.36
63 0.38
64 0.42
65 0.43
66 0.46
67 0.51
68 0.49
69 0.42
70 0.38
71 0.34
72 0.32
73 0.3
74 0.24
75 0.15
76 0.16
77 0.15
78 0.13
79 0.13
80 0.11
81 0.13
82 0.17
83 0.23
84 0.23
85 0.23
86 0.24
87 0.26
88 0.32
89 0.38
90 0.43
91 0.46
92 0.48
93 0.53
94 0.59
95 0.61
96 0.59
97 0.57
98 0.53
99 0.5
100 0.5
101 0.48
102 0.44
103 0.42
104 0.38
105 0.32
106 0.3
107 0.26
108 0.23
109 0.23
110 0.23
111 0.29
112 0.32
113 0.39
114 0.41
115 0.43
116 0.5
117 0.49
118 0.49
119 0.43
120 0.48
121 0.46
122 0.42
123 0.39
124 0.31
125 0.31
126 0.29
127 0.26
128 0.21
129 0.17
130 0.16
131 0.17
132 0.18
133 0.21
134 0.22
135 0.23
136 0.23
137 0.24
138 0.27
139 0.28
140 0.3
141 0.34
142 0.41
143 0.47
144 0.53
145 0.57
146 0.61
147 0.67
148 0.69
149 0.71
150 0.69
151 0.67
152 0.63
153 0.58
154 0.51
155 0.42
156 0.36
157 0.27
158 0.2
159 0.13
160 0.1
161 0.07
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.08
168 0.08
169 0.09
170 0.1
171 0.11
172 0.13
173 0.17
174 0.18
175 0.14
176 0.16
177 0.18
178 0.26
179 0.29
180 0.29
181 0.28
182 0.29
183 0.3
184 0.29
185 0.27
186 0.2
187 0.22
188 0.2
189 0.2
190 0.23
191 0.23
192 0.24
193 0.25
194 0.28
195 0.24
196 0.25
197 0.28
198 0.24
199 0.24
200 0.21
201 0.21
202 0.19
203 0.21
204 0.23
205 0.21
206 0.21
207 0.21
208 0.21
209 0.2
210 0.18
211 0.15
212 0.12
213 0.11
214 0.09
215 0.08
216 0.08
217 0.06
218 0.06
219 0.04
220 0.04
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.05
227 0.06
228 0.07
229 0.08
230 0.09
231 0.09
232 0.08
233 0.1
234 0.1
235 0.12
236 0.11
237 0.1
238 0.1
239 0.1
240 0.1
241 0.09
242 0.09
243 0.07
244 0.08
245 0.1
246 0.12
247 0.12
248 0.13
249 0.13
250 0.15
251 0.14
252 0.14
253 0.12
254 0.11
255 0.1
256 0.1
257 0.1
258 0.09
259 0.12
260 0.15
261 0.15
262 0.14
263 0.15
264 0.16
265 0.2
266 0.2
267 0.18
268 0.18
269 0.19
270 0.19
271 0.19
272 0.16
273 0.12
274 0.11
275 0.1
276 0.08
277 0.06
278 0.06
279 0.06
280 0.06
281 0.08
282 0.08
283 0.07
284 0.07
285 0.07
286 0.07
287 0.08
288 0.08
289 0.07
290 0.1
291 0.11
292 0.12
293 0.12
294 0.13
295 0.16
296 0.17
297 0.17
298 0.16
299 0.16
300 0.15
301 0.14
302 0.13
303 0.1
304 0.09
305 0.09
306 0.1
307 0.12
308 0.12
309 0.12
310 0.14
311 0.15
312 0.16
313 0.18
314 0.17
315 0.16
316 0.19
317 0.25
318 0.27
319 0.28
320 0.3
321 0.32
322 0.34
323 0.33
324 0.33
325 0.31
326 0.3
327 0.34
328 0.33
329 0.3
330 0.27
331 0.27
332 0.24
333 0.26
334 0.27
335 0.23
336 0.23
337 0.24
338 0.25
339 0.25
340 0.26
341 0.22
342 0.18
343 0.15
344 0.14
345 0.11
346 0.09
347 0.11
348 0.09
349 0.1
350 0.14
351 0.14
352 0.15
353 0.17
354 0.16
355 0.16
356 0.2
357 0.22
358 0.23
359 0.27
360 0.28
361 0.32
362 0.32
363 0.32
364 0.36
365 0.33
366 0.32
367 0.34
368 0.32
369 0.26
370 0.27
371 0.25
372 0.18
373 0.2
374 0.17
375 0.11
376 0.15
377 0.15
378 0.15
379 0.15
380 0.18
381 0.18
382 0.2
383 0.23
384 0.22
385 0.22
386 0.27
387 0.27
388 0.23
389 0.22
390 0.21
391 0.19
392 0.17
393 0.17
394 0.14
395 0.15
396 0.14
397 0.15
398 0.17
399 0.17
400 0.17
401 0.17
402 0.16
403 0.17
404 0.19
405 0.22
406 0.27
407 0.27
408 0.31
409 0.31
410 0.34
411 0.43
412 0.5
413 0.55
414 0.55
415 0.64
416 0.71
417 0.81
418 0.87
419 0.86
420 0.82
421 0.84
422 0.81
423 0.77
424 0.72
425 0.65