Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FC23

Protein Details
Accession A0A109FC23    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-80VTRGKGFTKEKNKKKRGSYRGGEITMHydrophilic
NLS Segment(s)
PositionSequence
60-71GFTKEKNKKKRG
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences GKGKGKQQQGMTERFRRVKAEEIEFVDERLKDNSFAARPAGMSDYGAKASADLIVTRGKGFTKEKNKKKRGSYRGGEITMASHSIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.54
4 0.51
5 0.51
6 0.49
7 0.47
8 0.43
9 0.42
10 0.45
11 0.41
12 0.39
13 0.33
14 0.26
15 0.22
16 0.2
17 0.17
18 0.12
19 0.13
20 0.16
21 0.15
22 0.15
23 0.15
24 0.13
25 0.12
26 0.12
27 0.13
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.08
35 0.06
36 0.06
37 0.07
38 0.06
39 0.05
40 0.06
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.13
47 0.17
48 0.25
49 0.35
50 0.46
51 0.56
52 0.66
53 0.75
54 0.79
55 0.86
56 0.88
57 0.86
58 0.86
59 0.83
60 0.82
61 0.81
62 0.74
63 0.64
64 0.53
65 0.45
66 0.36
67 0.31