Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZKC7

Protein Details
Accession E4ZKC7    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MWKRESFCRRQLQHRRLSRERKPHSITAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, nucl 5, cyto 1, extr 1, pero 1, E.R. 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009230  ATP_synth_su8_fun  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0045263  C:proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF05933  Fun_ATP-synt_8  
Amino Acid Sequences MWKRESFCRRQLQHRRLSRERKPHSITAHLLRAPKQSSSACLTLSQPTMNARFLRPFTRAAFRAPTAVRPTAMARPALVASQTKKPEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPNRVRLFAARLFISKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.88
5 0.86
6 0.86
7 0.84
8 0.84
9 0.8
10 0.78
11 0.73
12 0.69
13 0.66
14 0.61
15 0.6
16 0.53
17 0.5
18 0.45
19 0.46
20 0.41
21 0.35
22 0.33
23 0.27
24 0.28
25 0.3
26 0.29
27 0.23
28 0.23
29 0.24
30 0.22
31 0.22
32 0.19
33 0.15
34 0.16
35 0.18
36 0.2
37 0.19
38 0.18
39 0.2
40 0.22
41 0.24
42 0.24
43 0.25
44 0.24
45 0.29
46 0.29
47 0.28
48 0.29
49 0.26
50 0.29
51 0.26
52 0.27
53 0.25
54 0.24
55 0.22
56 0.2
57 0.21
58 0.2
59 0.21
60 0.17
61 0.13
62 0.13
63 0.13
64 0.12
65 0.11
66 0.1
67 0.11
68 0.17
69 0.19
70 0.18
71 0.18
72 0.19
73 0.25
74 0.29
75 0.35
76 0.31
77 0.31
78 0.35
79 0.37
80 0.37
81 0.3
82 0.24
83 0.17
84 0.15
85 0.16
86 0.12
87 0.1
88 0.1
89 0.11
90 0.11
91 0.14
92 0.13
93 0.12
94 0.12
95 0.12
96 0.12
97 0.11
98 0.11
99 0.09
100 0.09
101 0.08
102 0.08
103 0.07
104 0.06
105 0.06
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.07
112 0.07
113 0.08
114 0.1
115 0.12
116 0.18
117 0.25
118 0.27
119 0.34
120 0.37
121 0.4
122 0.39
123 0.39
124 0.39
125 0.35
126 0.37
127 0.32