Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FFC6

Protein Details
Accession A0A109FFC6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
416-466SEHARRAREERERERRRAEQEAARARRGKGERGMERQRKKEERERKAWIAYBasic
NLS Segment(s)
PositionSequence
419-461ARRAREERERERRRAEQEAARARRGKGERGMERQRKKEERERK
Subcellular Location(s) cyto 9, nucl 7, mito 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR039146  GPANK1  
Gene Ontology GO:0003676  F:nucleic acid binding  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MAASRPAFIFSYNAHDEDVAALVSSSATASTSRQAYAGLGIADSHARARQEVARYSRDDEDDDWVPTYGPTTHRKGKMRFVPARDPQLQTLPGRQEEVATDNDDERAQTEAAPTELAAPRQRAPAGTDIRNLYASIVGLNNKSPTTAPGITQSEPASRRTSPPPLPPPPTGKGTSASPEEARLSPRTKRPRTASPPPVPFEPARGRAVPVFPVREPDIVLSSDSEEEPDDSGAQGGGSSTKNSRRGRPGRGDDDDDGSADEDVDDDVVVIDPLTGLAEERRDRHQNTALRKRVQPLFIHQLLPRASSSSDSDAAAGAPLKPFVPPTQYAIKPDSPGWRLLARQGWREGLPLGPVPAVVAAASPSSDTLDGSPSGDPAAATAGRLKVPLRAVEKHDRSGIGVARAPHDRVVVGALGSEHARRAREERERERRRAEQEAARARRGKGERGMERQRKKEERERKAWIAYMNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.2
5 0.2
6 0.11
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.05
13 0.04
14 0.05
15 0.06
16 0.08
17 0.13
18 0.15
19 0.15
20 0.16
21 0.16
22 0.16
23 0.17
24 0.17
25 0.13
26 0.11
27 0.1
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.12
34 0.13
35 0.17
36 0.22
37 0.28
38 0.35
39 0.39
40 0.42
41 0.45
42 0.48
43 0.49
44 0.45
45 0.41
46 0.35
47 0.34
48 0.31
49 0.29
50 0.26
51 0.22
52 0.2
53 0.17
54 0.17
55 0.15
56 0.18
57 0.23
58 0.29
59 0.38
60 0.46
61 0.55
62 0.58
63 0.65
64 0.69
65 0.73
66 0.74
67 0.72
68 0.74
69 0.72
70 0.76
71 0.7
72 0.64
73 0.56
74 0.54
75 0.51
76 0.43
77 0.42
78 0.38
79 0.34
80 0.34
81 0.31
82 0.27
83 0.24
84 0.25
85 0.2
86 0.18
87 0.17
88 0.16
89 0.17
90 0.16
91 0.15
92 0.12
93 0.13
94 0.11
95 0.1
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.13
102 0.14
103 0.17
104 0.19
105 0.21
106 0.22
107 0.25
108 0.26
109 0.22
110 0.23
111 0.28
112 0.31
113 0.31
114 0.33
115 0.31
116 0.32
117 0.32
118 0.29
119 0.21
120 0.16
121 0.13
122 0.1
123 0.1
124 0.11
125 0.11
126 0.12
127 0.13
128 0.12
129 0.13
130 0.12
131 0.12
132 0.17
133 0.17
134 0.17
135 0.22
136 0.25
137 0.25
138 0.27
139 0.27
140 0.26
141 0.26
142 0.28
143 0.26
144 0.23
145 0.27
146 0.3
147 0.37
148 0.36
149 0.44
150 0.5
151 0.53
152 0.58
153 0.57
154 0.58
155 0.54
156 0.53
157 0.46
158 0.39
159 0.34
160 0.3
161 0.3
162 0.25
163 0.24
164 0.2
165 0.19
166 0.2
167 0.19
168 0.2
169 0.21
170 0.22
171 0.25
172 0.34
173 0.43
174 0.46
175 0.53
176 0.56
177 0.62
178 0.67
179 0.73
180 0.74
181 0.72
182 0.73
183 0.67
184 0.63
185 0.55
186 0.47
187 0.43
188 0.38
189 0.33
190 0.3
191 0.28
192 0.28
193 0.26
194 0.26
195 0.24
196 0.22
197 0.2
198 0.18
199 0.2
200 0.21
201 0.2
202 0.19
203 0.15
204 0.15
205 0.12
206 0.12
207 0.1
208 0.09
209 0.09
210 0.09
211 0.08
212 0.07
213 0.07
214 0.07
215 0.07
216 0.06
217 0.05
218 0.05
219 0.05
220 0.04
221 0.04
222 0.03
223 0.05
224 0.05
225 0.06
226 0.09
227 0.14
228 0.23
229 0.26
230 0.31
231 0.4
232 0.46
233 0.53
234 0.59
235 0.61
236 0.59
237 0.6
238 0.59
239 0.5
240 0.46
241 0.38
242 0.29
243 0.22
244 0.16
245 0.12
246 0.08
247 0.07
248 0.04
249 0.04
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.04
264 0.08
265 0.1
266 0.12
267 0.17
268 0.23
269 0.25
270 0.3
271 0.37
272 0.39
273 0.47
274 0.55
275 0.58
276 0.57
277 0.58
278 0.59
279 0.56
280 0.55
281 0.47
282 0.44
283 0.44
284 0.41
285 0.42
286 0.36
287 0.37
288 0.33
289 0.32
290 0.26
291 0.19
292 0.17
293 0.16
294 0.18
295 0.16
296 0.17
297 0.15
298 0.15
299 0.14
300 0.13
301 0.12
302 0.1
303 0.07
304 0.07
305 0.07
306 0.07
307 0.07
308 0.08
309 0.09
310 0.14
311 0.14
312 0.18
313 0.26
314 0.27
315 0.31
316 0.34
317 0.34
318 0.32
319 0.33
320 0.36
321 0.3
322 0.3
323 0.3
324 0.27
325 0.26
326 0.29
327 0.33
328 0.3
329 0.32
330 0.33
331 0.33
332 0.31
333 0.32
334 0.28
335 0.21
336 0.2
337 0.16
338 0.14
339 0.12
340 0.11
341 0.1
342 0.09
343 0.08
344 0.06
345 0.05
346 0.04
347 0.05
348 0.05
349 0.05
350 0.05
351 0.06
352 0.07
353 0.07
354 0.07
355 0.09
356 0.1
357 0.11
358 0.11
359 0.1
360 0.1
361 0.1
362 0.09
363 0.07
364 0.1
365 0.08
366 0.09
367 0.12
368 0.13
369 0.14
370 0.15
371 0.16
372 0.17
373 0.2
374 0.26
375 0.28
376 0.31
377 0.38
378 0.48
379 0.52
380 0.51
381 0.51
382 0.45
383 0.41
384 0.42
385 0.38
386 0.31
387 0.29
388 0.27
389 0.28
390 0.3
391 0.3
392 0.26
393 0.24
394 0.2
395 0.17
396 0.18
397 0.15
398 0.12
399 0.11
400 0.09
401 0.1
402 0.11
403 0.11
404 0.13
405 0.15
406 0.16
407 0.19
408 0.24
409 0.32
410 0.41
411 0.51
412 0.59
413 0.67
414 0.75
415 0.8
416 0.83
417 0.82
418 0.79
419 0.77
420 0.74
421 0.7
422 0.71
423 0.74
424 0.72
425 0.71
426 0.69
427 0.62
428 0.64
429 0.6
430 0.57
431 0.55
432 0.6
433 0.61
434 0.66
435 0.76
436 0.77
437 0.82
438 0.83
439 0.85
440 0.84
441 0.84
442 0.85
443 0.85
444 0.85
445 0.85
446 0.86
447 0.82
448 0.79
449 0.74