Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FBQ1

Protein Details
Accession A0A109FBQ1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29KYNFVTQPPQHTKRPRRRYDEIERMYHydrophilic
NLS Segment(s)
PositionSequence
65-78KEMRKAWRERKKAE
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences SSGKYNFVTQPPQHTKRPRRRYDEIERMYNCDYPGCTKSYGTLNHLNSHKTMQKHGPKATPAQFKEMRKAWRERKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.76
4 0.84
5 0.83
6 0.82
7 0.85
8 0.85
9 0.85
10 0.85
11 0.79
12 0.77
13 0.68
14 0.63
15 0.57
16 0.49
17 0.38
18 0.28
19 0.23
20 0.18
21 0.19
22 0.17
23 0.16
24 0.14
25 0.16
26 0.2
27 0.21
28 0.22
29 0.27
30 0.27
31 0.31
32 0.33
33 0.32
34 0.28
35 0.31
36 0.3
37 0.25
38 0.28
39 0.32
40 0.4
41 0.46
42 0.5
43 0.51
44 0.5
45 0.56
46 0.6
47 0.6
48 0.53
49 0.54
50 0.56
51 0.54
52 0.59
53 0.58
54 0.58
55 0.55
56 0.64
57 0.67
58 0.7