Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A489

Protein Details
Accession E5A489   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGHydrophilic
NLS Segment(s)
PositionSequence
14-42KKNHRNGIKKPKTHRYPSLKGTDPKFRRN
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALVQGGQGRQARCGINTTTTNERGGFDSFMRHLVGVNGIRTSYDGLELSSAEDGSSTHTSPRHEMWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.85
5 0.86
6 0.87
7 0.89
8 0.88
9 0.86
10 0.85
11 0.87
12 0.87
13 0.84
14 0.84
15 0.82
16 0.79
17 0.78
18 0.77
19 0.73
20 0.7
21 0.66
22 0.67
23 0.62
24 0.63
25 0.64
26 0.65
27 0.68
28 0.69
29 0.74
30 0.67
31 0.72
32 0.65
33 0.64
34 0.6
35 0.54
36 0.48
37 0.39
38 0.35
39 0.25
40 0.23
41 0.15
42 0.12
43 0.1
44 0.1
45 0.14
46 0.17
47 0.17
48 0.18
49 0.21
50 0.19
51 0.17
52 0.19
53 0.15
54 0.16
55 0.18
56 0.21
57 0.23
58 0.24
59 0.24
60 0.22
61 0.22
62 0.2
63 0.2
64 0.17
65 0.13
66 0.14
67 0.14
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.14
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.14
81 0.1
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.07
91 0.07
92 0.06
93 0.11
94 0.14
95 0.14
96 0.16
97 0.2
98 0.23
99 0.27