Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FB24

Protein Details
Accession A0A0B7FB24    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
842-866KPKNAGGTDKSKKKKLNPEAAASLRHydrophilic
NLS Segment(s)
PositionSequence
846-857AGGTDKSKKKKL
Subcellular Location(s) nucl 15.5, cyto_nucl 9.833, mito 4.5, cyto_mito 4.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR037794  TAF12  
IPR003228  TFIID_TAF12_dom  
Gene Ontology GO:0000124  C:SAGA complex  
GO:0046695  C:SLIK (SAGA-like) complex  
GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03847  TFIID_20kDa  
CDD cd07981  TAF12  
Amino Acid Sequences MGFHPQRPPQQAYANMAMMGMNAQNAQAQAARLQLQQLQVQQVQARAHAQAQQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQAQNQAQPQPQQRQQNQPMGNNGAGPSTGLSLASLSTETTPEQLAASQAKLAGLLQLTEHAGPAQSLSITAAVAPHLPQILALAKSGQLNGQQLAQLKTLVAMVAKNSGKLPNQLQRPAQGSPQVQAAGNSFPNSPATMNATPPQPPQQQSHLQNVNSQSPHLGQNMAPNQNLLSHMQPHAQAQQIPPQPTNHLPTPQQLHLQSQQLQAGQNHSHLNQQSHLQQSHLQNQAQLQAQNHGSPAPPNQVIGIKRKAPPGTLTLPPNELSHQTQQADNSSAGQMNGLQQGGQVNVTQMNGVAQANGFNQQANGVQVNGAQSQQPNGGAPQQNGQASQHSTRQMQAIVLDRARTIARTQGRSDEQYILTIARALMARFQQQQQERARAQQAVQAQAQQAQAQTQVAGMPGASQVQMPAQVQPQLTQPQAQPQQPSQPQAPVQVPHQPQQPPALPQSQPTPAISSGQPQSQSQPQLQSQPQPPAQVPQQPPSQPQQPQAGPSTLQPQISGPSLSGNAEAPATSSSQTRTTSDPSMAQINNVSQADETSPTLEANGENAPGTMTPSSPHTLNVKNPGPQAWPVPKNLKTFGSFRIGARPTLSQGLAGGPVLGTPSQLIRFGAGDEALGLGIGDAEAEEKEDTGASIATKKVGSMSEPGVGQPGKRTIQDLVAELDPRVTVDHEMESYLLARADEFIDSVMHFACRIAKHRGSDQVEPRDIQLHLERNHNIRIPGFASDEIRGALSRPAVEVKPKNAGGTDKSKKKKLNPEAAASLRAARVAAVQNARGMGRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.44
3 0.39
4 0.32
5 0.24
6 0.2
7 0.13
8 0.08
9 0.07
10 0.08
11 0.09
12 0.09
13 0.11
14 0.11
15 0.12
16 0.12
17 0.16
18 0.18
19 0.18
20 0.2
21 0.22
22 0.24
23 0.27
24 0.29
25 0.32
26 0.31
27 0.33
28 0.33
29 0.35
30 0.32
31 0.31
32 0.29
33 0.25
34 0.26
35 0.28
36 0.29
37 0.3
38 0.32
39 0.34
40 0.33
41 0.32
42 0.31
43 0.27
44 0.26
45 0.21
46 0.21
47 0.17
48 0.18
49 0.18
50 0.2
51 0.19
52 0.21
53 0.2
54 0.2
55 0.2
56 0.2
57 0.2
58 0.2
59 0.2
60 0.2
61 0.2
62 0.2
63 0.2
64 0.2
65 0.2
66 0.2
67 0.2
68 0.22
69 0.22
70 0.2
71 0.2
72 0.19
73 0.2
74 0.18
75 0.18
76 0.17
77 0.18
78 0.21
79 0.21
80 0.2
81 0.21
82 0.23
83 0.24
84 0.26
85 0.26
86 0.26
87 0.27
88 0.31
89 0.33
90 0.36
91 0.43
92 0.47
93 0.53
94 0.58
95 0.63
96 0.69
97 0.74
98 0.76
99 0.74
100 0.69
101 0.68
102 0.62
103 0.55
104 0.46
105 0.38
106 0.28
107 0.22
108 0.18
109 0.13
110 0.1
111 0.09
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.07
120 0.08
121 0.09
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.12
128 0.13
129 0.13
130 0.13
131 0.13
132 0.12
133 0.12
134 0.12
135 0.1
136 0.09
137 0.08
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.08
144 0.08
145 0.08
146 0.08
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.06
153 0.07
154 0.07
155 0.06
156 0.07
157 0.07
158 0.08
159 0.08
160 0.08
161 0.07
162 0.09
163 0.12
164 0.12
165 0.12
166 0.11
167 0.13
168 0.14
169 0.14
170 0.14
171 0.14
172 0.15
173 0.16
174 0.16
175 0.17
176 0.19
177 0.21
178 0.2
179 0.17
180 0.15
181 0.15
182 0.14
183 0.12
184 0.09
185 0.07
186 0.07
187 0.14
188 0.15
189 0.15
190 0.17
191 0.2
192 0.22
193 0.26
194 0.32
195 0.32
196 0.39
197 0.43
198 0.44
199 0.45
200 0.47
201 0.44
202 0.4
203 0.39
204 0.34
205 0.29
206 0.3
207 0.26
208 0.23
209 0.22
210 0.2
211 0.17
212 0.17
213 0.17
214 0.14
215 0.14
216 0.15
217 0.15
218 0.13
219 0.12
220 0.17
221 0.17
222 0.19
223 0.21
224 0.22
225 0.23
226 0.25
227 0.32
228 0.31
229 0.32
230 0.34
231 0.38
232 0.45
233 0.47
234 0.54
235 0.53
236 0.48
237 0.49
238 0.48
239 0.48
240 0.39
241 0.35
242 0.27
243 0.23
244 0.25
245 0.22
246 0.2
247 0.14
248 0.22
249 0.28
250 0.3
251 0.28
252 0.25
253 0.24
254 0.24
255 0.25
256 0.19
257 0.14
258 0.14
259 0.15
260 0.17
261 0.18
262 0.18
263 0.2
264 0.21
265 0.21
266 0.19
267 0.27
268 0.3
269 0.32
270 0.31
271 0.3
272 0.31
273 0.33
274 0.36
275 0.31
276 0.3
277 0.29
278 0.32
279 0.36
280 0.34
281 0.36
282 0.32
283 0.33
284 0.33
285 0.36
286 0.34
287 0.31
288 0.31
289 0.28
290 0.29
291 0.26
292 0.26
293 0.22
294 0.22
295 0.21
296 0.2
297 0.23
298 0.23
299 0.23
300 0.21
301 0.22
302 0.24
303 0.28
304 0.28
305 0.24
306 0.28
307 0.3
308 0.37
309 0.39
310 0.35
311 0.31
312 0.31
313 0.34
314 0.31
315 0.29
316 0.21
317 0.2
318 0.21
319 0.2
320 0.19
321 0.16
322 0.13
323 0.13
324 0.14
325 0.15
326 0.14
327 0.14
328 0.15
329 0.19
330 0.21
331 0.26
332 0.28
333 0.28
334 0.3
335 0.35
336 0.35
337 0.32
338 0.32
339 0.31
340 0.3
341 0.3
342 0.29
343 0.26
344 0.27
345 0.26
346 0.25
347 0.21
348 0.19
349 0.18
350 0.19
351 0.22
352 0.21
353 0.21
354 0.21
355 0.22
356 0.22
357 0.18
358 0.16
359 0.13
360 0.12
361 0.11
362 0.1
363 0.09
364 0.08
365 0.1
366 0.08
367 0.07
368 0.07
369 0.08
370 0.08
371 0.08
372 0.07
373 0.06
374 0.07
375 0.07
376 0.06
377 0.05
378 0.05
379 0.06
380 0.06
381 0.06
382 0.05
383 0.06
384 0.06
385 0.09
386 0.08
387 0.07
388 0.07
389 0.08
390 0.08
391 0.09
392 0.09
393 0.06
394 0.06
395 0.07
396 0.08
397 0.08
398 0.08
399 0.08
400 0.07
401 0.09
402 0.09
403 0.09
404 0.08
405 0.08
406 0.13
407 0.14
408 0.15
409 0.16
410 0.18
411 0.18
412 0.18
413 0.18
414 0.15
415 0.16
416 0.17
417 0.19
418 0.18
419 0.19
420 0.19
421 0.19
422 0.17
423 0.15
424 0.15
425 0.15
426 0.15
427 0.15
428 0.14
429 0.13
430 0.14
431 0.13
432 0.12
433 0.09
434 0.13
435 0.17
436 0.2
437 0.21
438 0.25
439 0.27
440 0.28
441 0.3
442 0.27
443 0.22
444 0.2
445 0.19
446 0.15
447 0.12
448 0.11
449 0.08
450 0.07
451 0.07
452 0.06
453 0.08
454 0.09
455 0.13
456 0.14
457 0.16
458 0.21
459 0.22
460 0.3
461 0.31
462 0.37
463 0.35
464 0.37
465 0.38
466 0.33
467 0.31
468 0.27
469 0.26
470 0.23
471 0.22
472 0.2
473 0.18
474 0.2
475 0.2
476 0.17
477 0.14
478 0.11
479 0.12
480 0.1
481 0.1
482 0.06
483 0.06
484 0.05
485 0.05
486 0.04
487 0.04
488 0.04
489 0.05
490 0.05
491 0.04
492 0.04
493 0.05
494 0.07
495 0.07
496 0.08
497 0.09
498 0.12
499 0.12
500 0.13
501 0.16
502 0.18
503 0.18
504 0.19
505 0.18
506 0.23
507 0.29
508 0.3
509 0.29
510 0.28
511 0.36
512 0.36
513 0.39
514 0.32
515 0.31
516 0.29
517 0.31
518 0.31
519 0.24
520 0.23
521 0.28
522 0.29
523 0.29
524 0.34
525 0.31
526 0.3
527 0.34
528 0.35
529 0.29
530 0.3
531 0.32
532 0.27
533 0.27
534 0.29
535 0.27
536 0.26
537 0.24
538 0.23
539 0.18
540 0.2
541 0.19
542 0.19
543 0.18
544 0.19
545 0.2
546 0.18
547 0.2
548 0.23
549 0.26
550 0.24
551 0.26
552 0.26
553 0.31
554 0.33
555 0.37
556 0.35
557 0.39
558 0.39
559 0.37
560 0.36
561 0.33
562 0.34
563 0.36
564 0.35
565 0.33
566 0.37
567 0.37
568 0.39
569 0.4
570 0.44
571 0.39
572 0.4
573 0.43
574 0.38
575 0.39
576 0.39
577 0.36
578 0.29
579 0.27
580 0.28
581 0.23
582 0.22
583 0.19
584 0.17
585 0.17
586 0.18
587 0.17
588 0.12
589 0.11
590 0.11
591 0.11
592 0.11
593 0.09
594 0.08
595 0.08
596 0.08
597 0.07
598 0.07
599 0.08
600 0.08
601 0.09
602 0.1
603 0.14
604 0.16
605 0.17
606 0.19
607 0.22
608 0.24
609 0.25
610 0.24
611 0.22
612 0.27
613 0.25
614 0.23
615 0.2
616 0.18
617 0.21
618 0.2
619 0.18
620 0.12
621 0.13
622 0.13
623 0.13
624 0.13
625 0.1
626 0.1
627 0.09
628 0.1
629 0.1
630 0.08
631 0.09
632 0.09
633 0.08
634 0.08
635 0.08
636 0.08
637 0.07
638 0.1
639 0.08
640 0.08
641 0.08
642 0.11
643 0.14
644 0.14
645 0.16
646 0.19
647 0.23
648 0.27
649 0.35
650 0.36
651 0.38
652 0.39
653 0.38
654 0.36
655 0.34
656 0.37
657 0.37
658 0.36
659 0.38
660 0.45
661 0.48
662 0.49
663 0.51
664 0.47
665 0.41
666 0.41
667 0.4
668 0.39
669 0.35
670 0.32
671 0.37
672 0.35
673 0.33
674 0.32
675 0.3
676 0.26
677 0.27
678 0.26
679 0.17
680 0.16
681 0.16
682 0.14
683 0.12
684 0.1
685 0.06
686 0.06
687 0.07
688 0.06
689 0.05
690 0.05
691 0.08
692 0.09
693 0.1
694 0.1
695 0.1
696 0.11
697 0.11
698 0.12
699 0.1
700 0.08
701 0.07
702 0.07
703 0.06
704 0.05
705 0.04
706 0.03
707 0.03
708 0.03
709 0.02
710 0.02
711 0.03
712 0.03
713 0.05
714 0.05
715 0.05
716 0.06
717 0.06
718 0.06
719 0.06
720 0.07
721 0.07
722 0.1
723 0.1
724 0.12
725 0.12
726 0.12
727 0.14
728 0.14
729 0.15
730 0.16
731 0.18
732 0.19
733 0.19
734 0.19
735 0.22
736 0.21
737 0.2
738 0.21
739 0.25
740 0.24
741 0.25
742 0.27
743 0.24
744 0.3
745 0.31
746 0.28
747 0.25
748 0.25
749 0.25
750 0.22
751 0.21
752 0.15
753 0.14
754 0.13
755 0.11
756 0.1
757 0.11
758 0.13
759 0.13
760 0.14
761 0.13
762 0.13
763 0.12
764 0.12
765 0.11
766 0.08
767 0.08
768 0.09
769 0.1
770 0.09
771 0.09
772 0.08
773 0.08
774 0.08
775 0.09
776 0.09
777 0.08
778 0.08
779 0.09
780 0.14
781 0.16
782 0.22
783 0.29
784 0.34
785 0.38
786 0.44
787 0.53
788 0.53
789 0.58
790 0.63
791 0.63
792 0.62
793 0.58
794 0.54
795 0.48
796 0.43
797 0.38
798 0.36
799 0.35
800 0.35
801 0.41
802 0.44
803 0.45
804 0.5
805 0.5
806 0.45
807 0.37
808 0.38
809 0.32
810 0.31
811 0.3
812 0.26
813 0.25
814 0.24
815 0.24
816 0.2
817 0.19
818 0.17
819 0.15
820 0.16
821 0.15
822 0.14
823 0.15
824 0.2
825 0.21
826 0.31
827 0.35
828 0.37
829 0.43
830 0.44
831 0.43
832 0.42
833 0.44
834 0.41
835 0.46
836 0.52
837 0.54
838 0.61
839 0.68
840 0.73
841 0.78
842 0.82
843 0.83
844 0.83
845 0.81
846 0.8
847 0.81
848 0.76
849 0.69
850 0.59
851 0.51
852 0.4
853 0.33
854 0.25
855 0.17
856 0.18
857 0.2
858 0.25
859 0.26
860 0.27
861 0.28
862 0.3