Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FNE6

Protein Details
Accession A0A0B7FNE6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ADTTQSKPQSGRRKRKPWCRTDTMKIHydrophilic
NLS Segment(s)
PositionSequence
22-25RRKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MWGRQRREIAADTTQSKPQSGRRKRKPWCRTDTMKISAHATRATLRLSPDFVPALASVQNSLLYKGLNTFGVLTNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.34
4 0.33
5 0.36
6 0.41
7 0.49
8 0.57
9 0.63
10 0.73
11 0.81
12 0.89
13 0.91
14 0.9
15 0.88
16 0.85
17 0.82
18 0.79
19 0.77
20 0.72
21 0.64
22 0.55
23 0.49
24 0.41
25 0.35
26 0.27
27 0.2
28 0.16
29 0.15
30 0.15
31 0.14
32 0.14
33 0.14
34 0.17
35 0.17
36 0.17
37 0.16
38 0.15
39 0.14
40 0.12
41 0.13
42 0.11
43 0.11
44 0.09
45 0.09
46 0.12
47 0.11
48 0.12
49 0.12
50 0.11
51 0.11
52 0.12
53 0.14
54 0.11
55 0.12
56 0.13