Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZMH4

Protein Details
Accession E4ZMH4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-38QPPEPSKQSSSKPKKKDSNPNKIKKTKRFSQNPHydrophilic
NLS Segment(s)
PositionSequence
16-33SKPKKKDSNPNKIKKTKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPNQTQPPEPSKQSSSKPKKKDSNPNKIKKTKRFSQNPTLAFPVAVVVSWTPIARRAFFSDIYKALKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.68
4 0.72
5 0.77
6 0.81
7 0.84
8 0.87
9 0.86
10 0.87
11 0.88
12 0.89
13 0.89
14 0.88
15 0.88
16 0.86
17 0.84
18 0.81
19 0.8
20 0.8
21 0.77
22 0.78
23 0.76
24 0.69
25 0.63
26 0.57
27 0.47
28 0.37
29 0.3
30 0.2
31 0.12
32 0.1
33 0.07
34 0.05
35 0.06
36 0.07
37 0.07
38 0.06
39 0.12
40 0.15
41 0.16
42 0.19
43 0.24
44 0.27
45 0.3
46 0.34
47 0.33
48 0.35
49 0.39