Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZZ18

Protein Details
Accession E4ZZ18    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
138-166NDQPPFSNHKCKPSRRNPLPGGKQRQSSKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPSSLMSNPSGQRATTKKTRKPLTSGARPTLRLRAHEQEPPFGEGNWATQRPRTQSSARPDAVVALEGFERRLKRLSGERCRVLLGGGFVAGDTGAVPRWHGACIKSDLTLVIPHSNSDSTPSILCYSTLATAQHEKNDQPPFSNHKCKPSRRNPLPGGKQRQSSKESGPFLILDILEGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.52
4 0.55
5 0.64
6 0.73
7 0.71
8 0.73
9 0.76
10 0.76
11 0.77
12 0.76
13 0.75
14 0.71
15 0.68
16 0.64
17 0.62
18 0.55
19 0.48
20 0.47
21 0.46
22 0.45
23 0.48
24 0.47
25 0.44
26 0.43
27 0.43
28 0.37
29 0.3
30 0.28
31 0.22
32 0.25
33 0.24
34 0.24
35 0.21
36 0.23
37 0.27
38 0.31
39 0.35
40 0.35
41 0.34
42 0.4
43 0.47
44 0.52
45 0.48
46 0.44
47 0.4
48 0.36
49 0.31
50 0.25
51 0.16
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.1
58 0.11
59 0.13
60 0.13
61 0.16
62 0.24
63 0.34
64 0.41
65 0.47
66 0.48
67 0.46
68 0.47
69 0.43
70 0.35
71 0.25
72 0.16
73 0.09
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.03
80 0.02
81 0.03
82 0.03
83 0.04
84 0.04
85 0.05
86 0.06
87 0.07
88 0.08
89 0.09
90 0.11
91 0.15
92 0.16
93 0.16
94 0.15
95 0.15
96 0.14
97 0.15
98 0.13
99 0.12
100 0.11
101 0.11
102 0.12
103 0.12
104 0.12
105 0.14
106 0.14
107 0.13
108 0.13
109 0.14
110 0.14
111 0.14
112 0.14
113 0.11
114 0.1
115 0.1
116 0.11
117 0.11
118 0.12
119 0.18
120 0.19
121 0.22
122 0.23
123 0.23
124 0.29
125 0.35
126 0.33
127 0.3
128 0.34
129 0.39
130 0.46
131 0.55
132 0.52
133 0.55
134 0.64
135 0.71
136 0.77
137 0.79
138 0.82
139 0.8
140 0.87
141 0.86
142 0.87
143 0.88
144 0.88
145 0.87
146 0.82
147 0.81
148 0.77
149 0.75
150 0.7
151 0.64
152 0.62
153 0.61
154 0.58
155 0.51
156 0.47
157 0.4
158 0.36
159 0.33
160 0.25
161 0.17