Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7F7A5

Protein Details
Accession A0A0B7F7A5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-99KTNLKNAAKHLKKYKKILRQKSLDAAKGHydrophilic
NLS Segment(s)
PositionSequence
80-90KHLKKYKKILR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.333, mito 7.5, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR017984  Chromo_dom_subgr  
IPR023780  Chromo_domain  
IPR023779  Chromodomain_CS  
Gene Ontology GO:1901363  F:heterocyclic compound binding  
GO:0097159  F:organic cyclic compound binding  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS00598  CHROMO_1  
PS50013  CHROMO_2  
Amino Acid Sequences MRIHNVFYVGILSKVKRNELQAWENRPPPITVDGEEEYKVKGIMDSQETKGKWEYLIKWKGYRPEESTWEPKTNLKNAAKHLKKYKKILRQKSLDAAKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.32
5 0.37
6 0.41
7 0.48
8 0.51
9 0.56
10 0.58
11 0.58
12 0.54
13 0.48
14 0.41
15 0.34
16 0.3
17 0.24
18 0.2
19 0.21
20 0.22
21 0.22
22 0.22
23 0.2
24 0.16
25 0.15
26 0.13
27 0.08
28 0.07
29 0.07
30 0.08
31 0.12
32 0.15
33 0.16
34 0.21
35 0.21
36 0.23
37 0.23
38 0.21
39 0.18
40 0.18
41 0.21
42 0.26
43 0.32
44 0.32
45 0.35
46 0.38
47 0.44
48 0.44
49 0.44
50 0.39
51 0.38
52 0.42
53 0.44
54 0.48
55 0.45
56 0.45
57 0.41
58 0.41
59 0.42
60 0.41
61 0.45
62 0.45
63 0.45
64 0.5
65 0.6
66 0.61
67 0.64
68 0.7
69 0.71
70 0.73
71 0.78
72 0.8
73 0.8
74 0.85
75 0.88
76 0.87
77 0.85
78 0.83
79 0.83
80 0.81