Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FLN2

Protein Details
Accession A0A0B7FLN2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-96EEFCKCRSHALRRQLRRSKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023184  Ubol_cytC_Rdtase_hinge_dom  
IPR036811  Ubol_cytC_Rdtase_hinge_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF02320  UCR_hinge  
Amino Acid Sequences MTFWSSLFPTLHADEEPPKEEQAQEEEEEEEEPEDVLPELREECKQTAACSGLDKHFVHCTEKVTAGEGFKGEDCVEEFCKCRSHALRRQLRRSKIIQQTPLDCSPVLERIDHTGFKQDIIENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.25
5 0.24
6 0.24
7 0.24
8 0.24
9 0.22
10 0.22
11 0.2
12 0.19
13 0.19
14 0.19
15 0.18
16 0.16
17 0.12
18 0.09
19 0.08
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.09
28 0.1
29 0.12
30 0.13
31 0.17
32 0.18
33 0.17
34 0.19
35 0.19
36 0.18
37 0.18
38 0.19
39 0.15
40 0.2
41 0.2
42 0.19
43 0.2
44 0.21
45 0.22
46 0.21
47 0.22
48 0.18
49 0.2
50 0.18
51 0.16
52 0.17
53 0.14
54 0.13
55 0.11
56 0.1
57 0.08
58 0.09
59 0.07
60 0.07
61 0.07
62 0.09
63 0.11
64 0.12
65 0.13
66 0.14
67 0.17
68 0.17
69 0.23
70 0.28
71 0.36
72 0.43
73 0.53
74 0.62
75 0.68
76 0.78
77 0.8
78 0.79
79 0.76
80 0.73
81 0.73
82 0.73
83 0.71
84 0.68
85 0.65
86 0.62
87 0.62
88 0.58
89 0.5
90 0.4
91 0.33
92 0.28
93 0.28
94 0.25
95 0.2
96 0.19
97 0.23
98 0.28
99 0.28
100 0.26
101 0.29
102 0.28
103 0.28
104 0.3