Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5BX64

Protein Details
Accession M5BX64    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-86VPPWPFLNRNPPKWRKVKGKHEHydrophilic
NLS Segment(s)
PositionSequence
76-85PKWRKVKGKH
Subcellular Location(s) plas 17, mito 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MSSQIQALIEGKIDFEGQELTETTMRYALTGATVFSFVAGYATQSLQICFGSLGLAVLAVMLAFVPPWPFLNRNPPKWRKVKGKHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.07
5 0.09
6 0.09
7 0.11
8 0.12
9 0.12
10 0.12
11 0.13
12 0.12
13 0.11
14 0.11
15 0.08
16 0.08
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.04
25 0.05
26 0.04
27 0.04
28 0.05
29 0.05
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.04
53 0.05
54 0.07
55 0.11
56 0.13
57 0.17
58 0.29
59 0.38
60 0.47
61 0.57
62 0.63
63 0.69
64 0.76
65 0.82
66 0.82