Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FY03

Protein Details
Accession A0A0B7FY03    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-113SAVRRPLKRPHRAIEREPKEBasic
NLS Segment(s)
PositionSequence
97-142RRPLKRPHRAIEREPKEKNADGQAKEQPRYKPPPPHVPLTVRRRQR
268-273KRAARR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MATASRSRFLISESALKLSLTPPPSASGTDSVSCTSSASSHSSSSFAVRRKQFRPTNVPNDQDRPHEARVHSESSNSLVSLGIVLVVSGAQPDSAVRRPLKRPHRAIEREPKEKNADGQAKEQPRYKPPPPHVPLTVRRRQRPIKLTRTLPLYHPLRPLPPLPSPAESEPSAPVEQNPATRSSGRTRRPPPRNLEHLIVAVSNTAKQRQGSPAKKRKVVVIAADEIDIDGDGESETNSSKKKKDSGSTLELAEEATFDDTDSGSGRAKRAARRSGGKDSSATPTPPPQELPATSKTQPARASGAQSKKPASSNARSTARRVTRRNSDETSSEEKDTAEFTLVPAQVPSAARRTSARRSAGIEHAEPIAISVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.28
4 0.26
5 0.23
6 0.26
7 0.21
8 0.21
9 0.19
10 0.22
11 0.24
12 0.25
13 0.26
14 0.23
15 0.24
16 0.25
17 0.25
18 0.23
19 0.22
20 0.21
21 0.18
22 0.15
23 0.13
24 0.14
25 0.17
26 0.18
27 0.19
28 0.19
29 0.2
30 0.21
31 0.25
32 0.29
33 0.29
34 0.36
35 0.42
36 0.5
37 0.52
38 0.61
39 0.63
40 0.66
41 0.71
42 0.73
43 0.75
44 0.75
45 0.77
46 0.72
47 0.71
48 0.65
49 0.59
50 0.56
51 0.51
52 0.47
53 0.48
54 0.42
55 0.43
56 0.45
57 0.45
58 0.39
59 0.34
60 0.31
61 0.28
62 0.28
63 0.21
64 0.16
65 0.11
66 0.11
67 0.1
68 0.08
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.08
81 0.12
82 0.18
83 0.21
84 0.28
85 0.35
86 0.45
87 0.55
88 0.61
89 0.65
90 0.68
91 0.76
92 0.77
93 0.79
94 0.81
95 0.79
96 0.78
97 0.72
98 0.68
99 0.62
100 0.57
101 0.51
102 0.49
103 0.48
104 0.41
105 0.44
106 0.47
107 0.47
108 0.49
109 0.51
110 0.46
111 0.46
112 0.52
113 0.54
114 0.56
115 0.57
116 0.65
117 0.63
118 0.64
119 0.61
120 0.61
121 0.63
122 0.63
123 0.64
124 0.6
125 0.62
126 0.66
127 0.67
128 0.69
129 0.69
130 0.7
131 0.72
132 0.72
133 0.69
134 0.65
135 0.63
136 0.55
137 0.47
138 0.46
139 0.39
140 0.35
141 0.35
142 0.32
143 0.29
144 0.3
145 0.3
146 0.25
147 0.25
148 0.26
149 0.24
150 0.25
151 0.26
152 0.25
153 0.26
154 0.22
155 0.21
156 0.18
157 0.18
158 0.17
159 0.14
160 0.13
161 0.13
162 0.14
163 0.15
164 0.15
165 0.14
166 0.16
167 0.17
168 0.19
169 0.24
170 0.31
171 0.34
172 0.42
173 0.49
174 0.57
175 0.65
176 0.69
177 0.7
178 0.69
179 0.71
180 0.65
181 0.59
182 0.5
183 0.42
184 0.35
185 0.27
186 0.19
187 0.12
188 0.09
189 0.09
190 0.09
191 0.1
192 0.11
193 0.11
194 0.14
195 0.21
196 0.31
197 0.38
198 0.48
199 0.57
200 0.62
201 0.66
202 0.64
203 0.6
204 0.56
205 0.51
206 0.44
207 0.38
208 0.33
209 0.29
210 0.28
211 0.23
212 0.17
213 0.14
214 0.09
215 0.06
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.05
223 0.06
224 0.1
225 0.13
226 0.17
227 0.21
228 0.28
229 0.33
230 0.39
231 0.45
232 0.5
233 0.53
234 0.51
235 0.48
236 0.41
237 0.35
238 0.29
239 0.21
240 0.13
241 0.07
242 0.06
243 0.06
244 0.05
245 0.06
246 0.05
247 0.06
248 0.07
249 0.08
250 0.1
251 0.12
252 0.13
253 0.18
254 0.23
255 0.29
256 0.37
257 0.43
258 0.47
259 0.54
260 0.59
261 0.64
262 0.63
263 0.58
264 0.52
265 0.47
266 0.46
267 0.4
268 0.35
269 0.27
270 0.29
271 0.3
272 0.3
273 0.29
274 0.26
275 0.28
276 0.29
277 0.32
278 0.31
279 0.33
280 0.33
281 0.38
282 0.37
283 0.38
284 0.37
285 0.35
286 0.37
287 0.33
288 0.39
289 0.41
290 0.48
291 0.48
292 0.5
293 0.5
294 0.48
295 0.48
296 0.48
297 0.48
298 0.48
299 0.5
300 0.55
301 0.6
302 0.59
303 0.6
304 0.63
305 0.64
306 0.65
307 0.64
308 0.64
309 0.66
310 0.71
311 0.74
312 0.69
313 0.64
314 0.57
315 0.57
316 0.56
317 0.49
318 0.44
319 0.37
320 0.33
321 0.29
322 0.27
323 0.22
324 0.16
325 0.12
326 0.12
327 0.18
328 0.19
329 0.18
330 0.17
331 0.16
332 0.18
333 0.2
334 0.21
335 0.21
336 0.21
337 0.23
338 0.28
339 0.35
340 0.41
341 0.48
342 0.5
343 0.47
344 0.51
345 0.55
346 0.57
347 0.56
348 0.48
349 0.42
350 0.37
351 0.34
352 0.28
353 0.24