Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FRK4

Protein Details
Accession A0A0B7FRK4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-115SVKEERRRKHTRAGASKPKAERKKVBasic
NLS Segment(s)
PositionSequence
90-114RSVKEERRRKHTRAGASKPKAERKK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007287  Sof1  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04158  Sof1  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MQRVFATTYTQDARFILSGSDDGNVRLWKARASEKLGVVEGREHASKEYRDRLRERWSMDKEIGRIERQQNLPVAVKKAGQLKRTMLDARSVKEERRRKHTRAGASKPKAERKKVVVVEQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.15
4 0.12
5 0.12
6 0.11
7 0.12
8 0.1
9 0.1
10 0.13
11 0.13
12 0.12
13 0.15
14 0.15
15 0.17
16 0.2
17 0.26
18 0.28
19 0.34
20 0.38
21 0.36
22 0.37
23 0.36
24 0.33
25 0.27
26 0.23
27 0.17
28 0.15
29 0.14
30 0.12
31 0.12
32 0.16
33 0.18
34 0.21
35 0.29
36 0.31
37 0.36
38 0.4
39 0.43
40 0.48
41 0.5
42 0.49
43 0.49
44 0.49
45 0.47
46 0.46
47 0.42
48 0.35
49 0.35
50 0.33
51 0.25
52 0.26
53 0.25
54 0.29
55 0.28
56 0.29
57 0.26
58 0.27
59 0.29
60 0.26
61 0.26
62 0.21
63 0.21
64 0.21
65 0.28
66 0.31
67 0.29
68 0.31
69 0.31
70 0.32
71 0.35
72 0.35
73 0.27
74 0.3
75 0.31
76 0.3
77 0.35
78 0.35
79 0.35
80 0.43
81 0.51
82 0.49
83 0.57
84 0.63
85 0.6
86 0.69
87 0.72
88 0.73
89 0.75
90 0.79
91 0.8
92 0.79
93 0.82
94 0.8
95 0.82
96 0.81
97 0.78
98 0.75
99 0.71
100 0.74
101 0.72