Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5C4V0

Protein Details
Accession M5C4V0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-51AGGKCHKPAKRREWRTLSRNEKKBasic
NLS Segment(s)
Subcellular Location(s) extr 23, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008922  Di-copper_centre_dom_sf  
Gene Ontology GO:0004497  F:monooxygenase activity  
Amino Acid Sequences MKLTGLLSVGALVLGALATDYEAEANAEAGGKCHKPAKRREWRTLSRNEKKAFVNAVKCLQEPYKYGKATSGILPTGDTPNVPAYNPKSSYYDDFASGERSQDLVGLCANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.1
18 0.1
19 0.12
20 0.18
21 0.21
22 0.27
23 0.37
24 0.47
25 0.55
26 0.63
27 0.72
28 0.75
29 0.81
30 0.81
31 0.82
32 0.82
33 0.8
34 0.79
35 0.71
36 0.65
37 0.57
38 0.53
39 0.47
40 0.41
41 0.35
42 0.29
43 0.31
44 0.28
45 0.27
46 0.26
47 0.22
48 0.2
49 0.19
50 0.24
51 0.27
52 0.26
53 0.26
54 0.26
55 0.27
56 0.26
57 0.27
58 0.22
59 0.15
60 0.15
61 0.16
62 0.15
63 0.15
64 0.14
65 0.11
66 0.1
67 0.14
68 0.14
69 0.14
70 0.18
71 0.2
72 0.27
73 0.29
74 0.3
75 0.3
76 0.33
77 0.37
78 0.36
79 0.34
80 0.29
81 0.28
82 0.26
83 0.28
84 0.25
85 0.22
86 0.18
87 0.16
88 0.14
89 0.16
90 0.15
91 0.12