Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FWM0

Protein Details
Accession A0A0B7FWM0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82PTDHTARNGREKREKARRTKBasic
NLS Segment(s)
PositionSequence
70-82NGREKREKARRTK
Subcellular Location(s) cyto 15, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MVKGACPGVAGFGPTPLFHGHNFGVLKVSNTFLFYGKIGATCEQGKPLEKTQEEPGAVTKDTPTDHTARNGREKREKARRTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.16
5 0.14
6 0.18
7 0.16
8 0.2
9 0.21
10 0.19
11 0.19
12 0.17
13 0.18
14 0.15
15 0.16
16 0.11
17 0.12
18 0.12
19 0.11
20 0.12
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.09
27 0.11
28 0.11
29 0.11
30 0.12
31 0.13
32 0.15
33 0.17
34 0.2
35 0.24
36 0.24
37 0.26
38 0.29
39 0.33
40 0.31
41 0.28
42 0.28
43 0.24
44 0.23
45 0.21
46 0.17
47 0.14
48 0.15
49 0.18
50 0.18
51 0.19
52 0.22
53 0.29
54 0.35
55 0.38
56 0.48
57 0.51
58 0.56
59 0.63
60 0.68
61 0.72
62 0.76