Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FGK9

Protein Details
Accession A0A0B7FGK9   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
90-113GDGTSKVERRKENRDKIKLQNFMKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MISARIVSQTTRHAYRGSFQTLKIRFASSSAEKVPTAPAAASSKLPISSCPVNTNLSGLTWLKGQPPVLALEDSEYPTWLWTLLDEKKAGDGTSKVERRKENRDKIKLQNFMKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.39
4 0.4
5 0.36
6 0.35
7 0.42
8 0.43
9 0.45
10 0.4
11 0.36
12 0.28
13 0.27
14 0.31
15 0.25
16 0.27
17 0.25
18 0.26
19 0.24
20 0.24
21 0.24
22 0.19
23 0.16
24 0.11
25 0.12
26 0.12
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.11
34 0.14
35 0.16
36 0.16
37 0.17
38 0.18
39 0.19
40 0.19
41 0.19
42 0.14
43 0.11
44 0.12
45 0.1
46 0.09
47 0.08
48 0.09
49 0.09
50 0.11
51 0.11
52 0.09
53 0.1
54 0.11
55 0.12
56 0.11
57 0.1
58 0.1
59 0.11
60 0.12
61 0.11
62 0.1
63 0.09
64 0.09
65 0.09
66 0.08
67 0.06
68 0.06
69 0.11
70 0.14
71 0.17
72 0.17
73 0.17
74 0.19
75 0.2
76 0.19
77 0.17
78 0.15
79 0.17
80 0.26
81 0.32
82 0.35
83 0.41
84 0.49
85 0.53
86 0.63
87 0.7
88 0.71
89 0.75
90 0.81
91 0.82
92 0.85
93 0.88
94 0.86
95 0.79