Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5BIJ1

Protein Details
Accession M5BIJ1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-91ANPNKGKVREEKPKPKPKEKADKEAABasic
NLS Segment(s)
PositionSequence
69-101NKGKVREEKPKPKPKEKADKEAAPKKKRVTKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKAATTKTTKAAKEPKEPKETKEKTPSPYQLFMKERLPKYKVENPEVPHKDAFRAVALEWKDADANPNKGKVREEKPKPKPKEKADKEAAPKKKRVTKKAAAAAAAASSEGEDDKEADDDDESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.69
4 0.73
5 0.74
6 0.69
7 0.7
8 0.68
9 0.66
10 0.67
11 0.64
12 0.59
13 0.66
14 0.7
15 0.64
16 0.66
17 0.6
18 0.58
19 0.56
20 0.53
21 0.51
22 0.52
23 0.5
24 0.51
25 0.5
26 0.44
27 0.49
28 0.53
29 0.52
30 0.5
31 0.52
32 0.47
33 0.56
34 0.56
35 0.51
36 0.45
37 0.39
38 0.34
39 0.29
40 0.27
41 0.17
42 0.14
43 0.11
44 0.14
45 0.15
46 0.14
47 0.13
48 0.12
49 0.12
50 0.11
51 0.14
52 0.13
53 0.18
54 0.18
55 0.23
56 0.24
57 0.25
58 0.28
59 0.32
60 0.36
61 0.41
62 0.5
63 0.56
64 0.65
65 0.75
66 0.8
67 0.83
68 0.84
69 0.84
70 0.86
71 0.82
72 0.81
73 0.79
74 0.78
75 0.78
76 0.78
77 0.78
78 0.73
79 0.72
80 0.7
81 0.72
82 0.74
83 0.73
84 0.74
85 0.73
86 0.76
87 0.78
88 0.74
89 0.65
90 0.56
91 0.48
92 0.38
93 0.29
94 0.19
95 0.1
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.08
103 0.09
104 0.1
105 0.1