Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZIJ9

Protein Details
Accession E4ZIJ9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
220-254ETEEKPRPKKVGRPPKDKKEPAKKREPKKAATADGBasic
NLS Segment(s)
PositionSequence
223-264EKPRPKKVGRPPKDKKEPAKKREPKKAATADGQPRRSGRNRS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MTESEIQKGDQVSWNWGSGNPGGKVAEVKEQGEIAIESNRGNTIKKNAEPENPAVHIERSGNDVVKRASELNIEKKADGANGQSNGDEKEEEKEDKKEELEKVEDKKEESEKKDEKPADPKSKDEEMKDAPATEKEDVKTNGESKDEAKDESKTESKDEPKDNAKEVKDDAKDEGSTDESATRADEAEDSAKTGSKRKAEDSPAKETNGDSKKAKTDDAETEEKPRPKKVGRPPKDKKEPAKKREPKKAATADGQPRRSGRNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.27
4 0.27
5 0.24
6 0.28
7 0.23
8 0.23
9 0.23
10 0.22
11 0.24
12 0.22
13 0.27
14 0.23
15 0.23
16 0.22
17 0.22
18 0.21
19 0.2
20 0.19
21 0.12
22 0.13
23 0.13
24 0.12
25 0.12
26 0.15
27 0.15
28 0.16
29 0.18
30 0.24
31 0.3
32 0.34
33 0.4
34 0.42
35 0.47
36 0.5
37 0.51
38 0.48
39 0.42
40 0.4
41 0.35
42 0.31
43 0.26
44 0.23
45 0.19
46 0.18
47 0.19
48 0.2
49 0.19
50 0.21
51 0.2
52 0.2
53 0.21
54 0.18
55 0.17
56 0.2
57 0.24
58 0.28
59 0.34
60 0.34
61 0.32
62 0.32
63 0.31
64 0.27
65 0.23
66 0.19
67 0.17
68 0.18
69 0.18
70 0.18
71 0.18
72 0.18
73 0.18
74 0.15
75 0.1
76 0.12
77 0.15
78 0.17
79 0.19
80 0.21
81 0.22
82 0.23
83 0.24
84 0.26
85 0.25
86 0.26
87 0.28
88 0.3
89 0.32
90 0.35
91 0.34
92 0.3
93 0.32
94 0.36
95 0.37
96 0.36
97 0.42
98 0.42
99 0.43
100 0.5
101 0.49
102 0.45
103 0.48
104 0.53
105 0.54
106 0.51
107 0.51
108 0.48
109 0.53
110 0.52
111 0.44
112 0.4
113 0.32
114 0.33
115 0.31
116 0.26
117 0.2
118 0.19
119 0.2
120 0.16
121 0.16
122 0.13
123 0.18
124 0.18
125 0.2
126 0.2
127 0.2
128 0.21
129 0.19
130 0.2
131 0.16
132 0.19
133 0.18
134 0.17
135 0.17
136 0.17
137 0.17
138 0.21
139 0.23
140 0.2
141 0.22
142 0.26
143 0.3
144 0.34
145 0.37
146 0.37
147 0.41
148 0.42
149 0.43
150 0.44
151 0.39
152 0.35
153 0.34
154 0.37
155 0.32
156 0.3
157 0.28
158 0.25
159 0.24
160 0.22
161 0.21
162 0.15
163 0.14
164 0.13
165 0.12
166 0.1
167 0.1
168 0.1
169 0.08
170 0.07
171 0.07
172 0.07
173 0.08
174 0.1
175 0.09
176 0.1
177 0.1
178 0.13
179 0.13
180 0.2
181 0.24
182 0.27
183 0.3
184 0.33
185 0.41
186 0.47
187 0.56
188 0.55
189 0.58
190 0.56
191 0.54
192 0.51
193 0.44
194 0.45
195 0.4
196 0.39
197 0.33
198 0.33
199 0.38
200 0.4
201 0.41
202 0.34
203 0.34
204 0.37
205 0.41
206 0.43
207 0.37
208 0.42
209 0.48
210 0.51
211 0.49
212 0.46
213 0.48
214 0.48
215 0.57
216 0.62
217 0.66
218 0.7
219 0.78
220 0.84
221 0.88
222 0.92
223 0.92
224 0.92
225 0.92
226 0.92
227 0.91
228 0.92
229 0.9
230 0.9
231 0.91
232 0.89
233 0.84
234 0.84
235 0.83
236 0.78
237 0.75
238 0.74
239 0.74
240 0.74
241 0.71
242 0.65
243 0.59
244 0.61