Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FDL3

Protein Details
Accession A0A0B7FDL3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
62-88HDPARSIAKRPRRRAARSPTVGRRCVDHydrophilic
NLS Segment(s)
PositionSequence
69-78AKRPRRRAAR
Subcellular Location(s) extr 10, cyto 8, nucl 5, plas 2
Family & Domain DBs
Amino Acid Sequences MLDTTSTDEGGWRVSRDLSLGVTPALVTGNKNYLNSLVVCLLFTTQLVSSPFAQSWSLAVLHDPARSIAKRPRRRAARSPTVGRRCVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.16
5 0.13
6 0.12
7 0.12
8 0.1
9 0.09
10 0.09
11 0.08
12 0.08
13 0.07
14 0.07
15 0.08
16 0.12
17 0.14
18 0.14
19 0.14
20 0.14
21 0.15
22 0.14
23 0.14
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.06
30 0.06
31 0.06
32 0.04
33 0.07
34 0.08
35 0.09
36 0.1
37 0.11
38 0.11
39 0.12
40 0.12
41 0.1
42 0.09
43 0.09
44 0.09
45 0.07
46 0.08
47 0.09
48 0.1
49 0.11
50 0.11
51 0.11
52 0.15
53 0.16
54 0.21
55 0.27
56 0.37
57 0.47
58 0.55
59 0.64
60 0.7
61 0.77
62 0.82
63 0.84
64 0.84
65 0.84
66 0.85
67 0.86
68 0.84