FuNGI

E4ZVJ5

Protein Details

Accession

E4ZVJ5

Localization Confidence

Medium

Confidence Score

14.1

NoLS Segment(s)

Position	Sequence	Protein Nature
67-90	DAAEGAKPKRKYNKKPKFDESGAV	Hydrophilic

NLS Segment(s)

Position	Sequence
72-102	AKPKRKYNKKPKFDESGAVIPPGKPGPKKRV
117-119	RKP

Subcellular Location(s)

nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0003743 F:translation initiation factor activity GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MKLKLKNPTAAPAHASGEAPSADAATPVSAKPGGGLKLKLKPAASSTPVAPSTASAPAAPVAPTAPDAAEGAKPKRKYNKKPKFDESGAVIPPGKPGPKKRVRDDENDELDTPAAKRKPKPTAKSLAMANDSSDDEVMAEPAPRPQPPTQRVPSLKLSIKPKTGASGTPAQPGTKTAILKVKGAGKPPVRPYGVGYDSEAEEAEVDPAIESQFVLRMQPGPDCDLLRKSIEEKTIGKSVSAGGPGVYFRFFDREGRRALIQIQNRQYAATMVELPAVIESLKSWNKKDWVKTADICQMLLVLGRVNNEEEAKKYPRPSYVEPDSHRFPHGLTPPMQWARKLRFRPRKSYLDVERAEAQMNRLLAEDEKAISTRYELIDSGDESSDNSSSEEELDDEEMPDGNQVEDEGMDAAEIEQMLHAGFMEDDEVEVTGNGDDLEAMFGNSDNTLQVETPTTAHDVAMHAINPNGSITLETDTAASTPGAATSADDDDDDDDADSDDEVDEVDEAAAAEEQRQEQLRAEIAELEKAIAQSVEQRERHTNLMYKKRLQATIDKQKADLIIKQRQLNEEVEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.34
3	0.26
4	0.24
5	0.21
6	0.17
7	0.14
8	0.13
9	0.11
10	0.11
11	0.1
12	0.09
13	0.1
14	0.1
15	0.13
16	0.12
17	0.12
18	0.14
19	0.18
20	0.21
21	0.25
22	0.3
23	0.33
24	0.4
25	0.45
26	0.47
27	0.43
28	0.41
29	0.42
30	0.45
31	0.42
32	0.38
33	0.35
34	0.37
35	0.37
36	0.35
37	0.29
38	0.22
39	0.21
40	0.21
41	0.21
42	0.14
43	0.14
44	0.14
45	0.15
46	0.14
47	0.12
48	0.09
49	0.09
50	0.1
51	0.1
52	0.1
53	0.09
54	0.1
55	0.11
56	0.14
57	0.19
58	0.25
59	0.31
60	0.34
61	0.41
62	0.51
63	0.61
64	0.68
65	0.74
66	0.79
67	0.82
68	0.89
69	0.89
70	0.88
71	0.8
72	0.75
73	0.69
74	0.65
75	0.56
76	0.48
77	0.42
78	0.32
79	0.31
80	0.3
81	0.29
82	0.28
83	0.35
84	0.44
85	0.52
86	0.61
87	0.67
88	0.75
89	0.75
90	0.79
91	0.79
92	0.79
93	0.75
94	0.69
95	0.6
96	0.5
97	0.44
98	0.35
99	0.28
100	0.25
101	0.24
102	0.27
103	0.32
104	0.4
105	0.51
106	0.59
107	0.66
108	0.67
109	0.73
110	0.71
111	0.7
112	0.64
113	0.6
114	0.53
115	0.45
116	0.37
117	0.29
118	0.25
119	0.21
120	0.17
121	0.11
122	0.08
123	0.08
124	0.08
125	0.07
126	0.07
127	0.07
128	0.12
129	0.14
130	0.14
131	0.19
132	0.25
133	0.34
134	0.39
135	0.48
136	0.48
137	0.55
138	0.58
139	0.58
140	0.58
141	0.55
142	0.54
143	0.51
144	0.54
145	0.5
146	0.5
147	0.47
148	0.42
149	0.39
150	0.36
151	0.32
152	0.29
153	0.31
154	0.29
155	0.33
156	0.33
157	0.29
158	0.27
159	0.27
160	0.27
161	0.22
162	0.21
163	0.19
164	0.25
165	0.26
166	0.27
167	0.29
168	0.33
169	0.31
170	0.34
171	0.38
172	0.36
173	0.41
174	0.45
175	0.49
176	0.42
177	0.4
178	0.39
179	0.39
180	0.37
181	0.31
182	0.28
183	0.22
184	0.21
185	0.21
186	0.18
187	0.1
188	0.08
189	0.08
190	0.07
191	0.05
192	0.05
193	0.04
194	0.05
195	0.05
196	0.04
197	0.04
198	0.04
199	0.06
200	0.06
201	0.06
202	0.07
203	0.09
204	0.1
205	0.12
206	0.13
207	0.14
208	0.16
209	0.16
210	0.17
211	0.17
212	0.18
213	0.17
214	0.17
215	0.16
216	0.18
217	0.2
218	0.21
219	0.22
220	0.23
221	0.26
222	0.25
223	0.23
224	0.2
225	0.19
226	0.17
227	0.15
228	0.12
229	0.08
230	0.08
231	0.08
232	0.08
233	0.08
234	0.06
235	0.06
236	0.09
237	0.1
238	0.16
239	0.2
240	0.23
241	0.25
242	0.27
243	0.27
244	0.25
245	0.28
246	0.28
247	0.28
248	0.32
249	0.34
250	0.34
251	0.34
252	0.33
253	0.29
254	0.24
255	0.19
256	0.13
257	0.09
258	0.07
259	0.07
260	0.07
261	0.07
262	0.06
263	0.05
264	0.04
265	0.03
266	0.04
267	0.08
268	0.12
269	0.14
270	0.16
271	0.19
272	0.25
273	0.29
274	0.33
275	0.36
276	0.36
277	0.38
278	0.38
279	0.39
280	0.39
281	0.35
282	0.31
283	0.23
284	0.19
285	0.15
286	0.14
287	0.1
288	0.05
289	0.05
290	0.06
291	0.06
292	0.07
293	0.07
294	0.08
295	0.09
296	0.1
297	0.14
298	0.18
299	0.2
300	0.23
301	0.25
302	0.29
303	0.34
304	0.36
305	0.39
306	0.43
307	0.47
308	0.47
309	0.49
310	0.47
311	0.43
312	0.4
313	0.32
314	0.25
315	0.25
316	0.26
317	0.25
318	0.24
319	0.24
320	0.3
321	0.35
322	0.35
323	0.31
324	0.33
325	0.36
326	0.42
327	0.49
328	0.53
329	0.59
330	0.64
331	0.71
332	0.73
333	0.74
334	0.71
335	0.71
336	0.67
337	0.66
338	0.6
339	0.54
340	0.49
341	0.41
342	0.38
343	0.29
344	0.24
345	0.17
346	0.16
347	0.13
348	0.11
349	0.11
350	0.1
351	0.1
352	0.1
353	0.08
354	0.08
355	0.08
356	0.09
357	0.08
358	0.09
359	0.1
360	0.1
361	0.11
362	0.11
363	0.12
364	0.12
365	0.13
366	0.14
367	0.11
368	0.1
369	0.1
370	0.11
371	0.1
372	0.09
373	0.09
374	0.07
375	0.07
376	0.08
377	0.08
378	0.07
379	0.07
380	0.09
381	0.08
382	0.08
383	0.08
384	0.08
385	0.07
386	0.08
387	0.07
388	0.06
389	0.05
390	0.05
391	0.05
392	0.05
393	0.05
394	0.05
395	0.04
396	0.04
397	0.04
398	0.04
399	0.04
400	0.04
401	0.04
402	0.03
403	0.04
404	0.04
405	0.04
406	0.04
407	0.03
408	0.03
409	0.03
410	0.04
411	0.04
412	0.04
413	0.04
414	0.05
415	0.04
416	0.04
417	0.05
418	0.04
419	0.04
420	0.04
421	0.04
422	0.04
423	0.04
424	0.05
425	0.05
426	0.05
427	0.05
428	0.05
429	0.06
430	0.06
431	0.06
432	0.05
433	0.06
434	0.07
435	0.07
436	0.07
437	0.09
438	0.1
439	0.11
440	0.12
441	0.14
442	0.13
443	0.13
444	0.13
445	0.12
446	0.13
447	0.13
448	0.12
449	0.11
450	0.11
451	0.11
452	0.11
453	0.1
454	0.09
455	0.07
456	0.07
457	0.08
458	0.1
459	0.1
460	0.1
461	0.1
462	0.1
463	0.1
464	0.1
465	0.09
466	0.06
467	0.06
468	0.06
469	0.06
470	0.06
471	0.07
472	0.08
473	0.09
474	0.09
475	0.09
476	0.1
477	0.1
478	0.11
479	0.11
480	0.08
481	0.08
482	0.08
483	0.08
484	0.07
485	0.07
486	0.06
487	0.06
488	0.05
489	0.05
490	0.05
491	0.05
492	0.05
493	0.05
494	0.05
495	0.05
496	0.06
497	0.06
498	0.07
499	0.09
500	0.1
501	0.14
502	0.16
503	0.17
504	0.18
505	0.21
506	0.23
507	0.22
508	0.22
509	0.23
510	0.22
511	0.23
512	0.21
513	0.19
514	0.17
515	0.16
516	0.16
517	0.11
518	0.1
519	0.15
520	0.23
521	0.31
522	0.31
523	0.36
524	0.42
525	0.45
526	0.49
527	0.47
528	0.47
529	0.48
530	0.58
531	0.61
532	0.61
533	0.66
534	0.69
535	0.68
536	0.65
537	0.66
538	0.66
539	0.69
540	0.71
541	0.64
542	0.58
543	0.55
544	0.56
545	0.49
546	0.45
547	0.42
548	0.43
549	0.49
550	0.54
551	0.55
552	0.54
553	0.54

E4ZVJ5

3D AlphaFold-predicted Structure Viewer