Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FAT3

Protein Details
Accession A0A0B7FAT3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
137-156AGERRKPPAPPARRKPPAVPBasic
NLS Segment(s)
PositionSequence
137-153AGERRKPPAPPARRKPP
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MDLLGAQVEPVYRSVSAEPVLRSLDKLKIGDKTANGSTSSLTDVAVADAPLSLAGVRPGVDSKTGRIAPAPPARRVPPLKQFTDPPSSPTPPLSPSKSSTYSSASEPASYRYGTEQIHVIGHSRDGGAVGSGGGAGAGERRKPPAPPARRKPPAVPVRVQTVEIGPGGTRITTIASSGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.2
5 0.2
6 0.2
7 0.23
8 0.21
9 0.22
10 0.22
11 0.25
12 0.25
13 0.26
14 0.27
15 0.29
16 0.32
17 0.34
18 0.32
19 0.32
20 0.31
21 0.31
22 0.28
23 0.24
24 0.22
25 0.19
26 0.19
27 0.14
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.03
41 0.04
42 0.04
43 0.05
44 0.05
45 0.07
46 0.07
47 0.11
48 0.11
49 0.12
50 0.19
51 0.19
52 0.18
53 0.18
54 0.2
55 0.24
56 0.32
57 0.34
58 0.3
59 0.33
60 0.35
61 0.41
62 0.43
63 0.41
64 0.42
65 0.45
66 0.45
67 0.44
68 0.45
69 0.42
70 0.45
71 0.4
72 0.34
73 0.33
74 0.32
75 0.31
76 0.29
77 0.26
78 0.22
79 0.26
80 0.25
81 0.23
82 0.24
83 0.28
84 0.3
85 0.3
86 0.29
87 0.28
88 0.26
89 0.25
90 0.25
91 0.21
92 0.19
93 0.18
94 0.19
95 0.17
96 0.15
97 0.15
98 0.13
99 0.16
100 0.15
101 0.15
102 0.14
103 0.13
104 0.14
105 0.13
106 0.13
107 0.1
108 0.1
109 0.1
110 0.08
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.02
123 0.05
124 0.07
125 0.09
126 0.11
127 0.15
128 0.17
129 0.19
130 0.29
131 0.36
132 0.46
133 0.55
134 0.64
135 0.71
136 0.77
137 0.8
138 0.77
139 0.77
140 0.76
141 0.71
142 0.67
143 0.59
144 0.6
145 0.56
146 0.51
147 0.42
148 0.34
149 0.29
150 0.24
151 0.21
152 0.13
153 0.12
154 0.12
155 0.1
156 0.09
157 0.08
158 0.1
159 0.09
160 0.11