Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FPS5

Protein Details
Accession A0A0B7FPS5   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-93RSPSPPRRPYSPPRRNRRPPSPVRNRRPPQPARRRTPPRRFGGDBasic
NLS Segment(s)
PositionSequence
51-91SPSPPRRPYSPPRRNRRPPSPVRNRRPPQPARRRTPPRRFG
Subcellular Location(s) nucl 12, cyto_nucl 11, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MPIHQKSGQTKGSAHVEFFDSQAAKTAVTHMNTGLLDGATLLVELSDPPRSPSPPRRPYSPPRRNRRPPSPVRNRRPPQPARRRTPPRRFGGDSYRPRSLSPSRRVAVGADHILAAGPDLVRPHLTHVRREVCPDPGAGPGPVLAPAPAPTPARLRGQGVLAEARRGLAPPSLKHTLHASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.31
3 0.3
4 0.28
5 0.27
6 0.26
7 0.18
8 0.17
9 0.21
10 0.2
11 0.17
12 0.16
13 0.21
14 0.21
15 0.21
16 0.22
17 0.17
18 0.2
19 0.2
20 0.2
21 0.16
22 0.1
23 0.09
24 0.08
25 0.08
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.04
32 0.05
33 0.08
34 0.08
35 0.11
36 0.14
37 0.17
38 0.25
39 0.35
40 0.45
41 0.52
42 0.55
43 0.58
44 0.64
45 0.72
46 0.76
47 0.76
48 0.75
49 0.76
50 0.83
51 0.88
52 0.89
53 0.89
54 0.88
55 0.88
56 0.89
57 0.9
58 0.9
59 0.88
60 0.9
61 0.84
62 0.81
63 0.81
64 0.79
65 0.79
66 0.79
67 0.8
68 0.76
69 0.83
70 0.86
71 0.86
72 0.87
73 0.85
74 0.8
75 0.78
76 0.73
77 0.66
78 0.65
79 0.64
80 0.62
81 0.58
82 0.55
83 0.48
84 0.45
85 0.46
86 0.45
87 0.44
88 0.43
89 0.46
90 0.43
91 0.43
92 0.43
93 0.38
94 0.32
95 0.26
96 0.2
97 0.13
98 0.12
99 0.11
100 0.1
101 0.1
102 0.07
103 0.05
104 0.04
105 0.04
106 0.05
107 0.06
108 0.07
109 0.07
110 0.13
111 0.2
112 0.23
113 0.27
114 0.34
115 0.39
116 0.39
117 0.45
118 0.42
119 0.38
120 0.37
121 0.33
122 0.26
123 0.23
124 0.23
125 0.18
126 0.16
127 0.12
128 0.11
129 0.11
130 0.1
131 0.08
132 0.07
133 0.08
134 0.09
135 0.12
136 0.13
137 0.15
138 0.19
139 0.23
140 0.27
141 0.28
142 0.3
143 0.29
144 0.3
145 0.29
146 0.28
147 0.31
148 0.26
149 0.26
150 0.23
151 0.22
152 0.19
153 0.18
154 0.17
155 0.16
156 0.21
157 0.22
158 0.3
159 0.36
160 0.36
161 0.37