Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A5Y4

Protein Details
Accession E5A5Y4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-57TVPKMKKGRSHQHHEKKPTFKKGCBasic
NLS Segment(s)
PositionSequence
39-49KKGRSHQHHEK
Subcellular Location(s) mito 17.5, cyto_mito 10, nucl 3, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MKTTVLALLLAATVFSDTFAWAAPSVDAVVPRNTVPKMKKGRSHQHHEKKPTFKKGCNCQKQIIPNKLSKQMYAGTYECRGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.06
9 0.07
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.09
16 0.1
17 0.1
18 0.11
19 0.14
20 0.14
21 0.19
22 0.2
23 0.27
24 0.35
25 0.4
26 0.46
27 0.52
28 0.62
29 0.64
30 0.72
31 0.74
32 0.76
33 0.79
34 0.81
35 0.8
36 0.8
37 0.8
38 0.81
39 0.76
40 0.72
41 0.73
42 0.75
43 0.78
44 0.78
45 0.74
46 0.68
47 0.68
48 0.71
49 0.72
50 0.71
51 0.65
52 0.62
53 0.63
54 0.67
55 0.62
56 0.52
57 0.46
58 0.41
59 0.38
60 0.36
61 0.32
62 0.28
63 0.29