Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7F841

Protein Details
Accession A0A0B7F841    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
71-90VTGHRTRREKRRGLSRKVQLBasic
NLS Segment(s)
PositionSequence
76-86TRREKRRGLSR
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MIQTHAHHQTTFHPPPPPPSLPHGMWFRSHPTEIKFINQSTHSAGKGSQPIEANVLSPSRYTGGGRCDDRVTGHRTRREKRRGLSRKVQLPLIPRPTVGQLDVKSWDSFVRHDRARSLQGRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.53
4 0.5
5 0.43
6 0.44
7 0.46
8 0.42
9 0.47
10 0.46
11 0.4
12 0.39
13 0.38
14 0.37
15 0.35
16 0.35
17 0.32
18 0.29
19 0.34
20 0.33
21 0.35
22 0.32
23 0.29
24 0.3
25 0.28
26 0.27
27 0.24
28 0.26
29 0.22
30 0.19
31 0.19
32 0.19
33 0.22
34 0.21
35 0.2
36 0.18
37 0.18
38 0.19
39 0.19
40 0.16
41 0.12
42 0.12
43 0.09
44 0.08
45 0.09
46 0.07
47 0.08
48 0.08
49 0.09
50 0.13
51 0.17
52 0.18
53 0.19
54 0.19
55 0.18
56 0.2
57 0.21
58 0.24
59 0.27
60 0.32
61 0.38
62 0.46
63 0.53
64 0.62
65 0.68
66 0.7
67 0.7
68 0.75
69 0.77
70 0.78
71 0.8
72 0.78
73 0.76
74 0.71
75 0.67
76 0.58
77 0.54
78 0.54
79 0.51
80 0.43
81 0.35
82 0.34
83 0.34
84 0.33
85 0.29
86 0.26
87 0.21
88 0.23
89 0.26
90 0.27
91 0.24
92 0.23
93 0.23
94 0.19
95 0.22
96 0.25
97 0.3
98 0.32
99 0.35
100 0.39
101 0.43
102 0.5
103 0.51