Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FWA8

Protein Details
Accession A0A0B7FWA8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MWWRWRWKKARSVDRRDEIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MWWRWRWKKARSVDRRDEIGSFATNDVVMFIFIFSTYQLSQWQRSNAAWSSSSPIHLLSPRHLLSSSTTTYGAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.71
4 0.61
5 0.51
6 0.43
7 0.33
8 0.24
9 0.18
10 0.14
11 0.12
12 0.11
13 0.09
14 0.07
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.06
25 0.1
26 0.12
27 0.15
28 0.18
29 0.2
30 0.2
31 0.2
32 0.24
33 0.21
34 0.22
35 0.2
36 0.18
37 0.21
38 0.2
39 0.21
40 0.17
41 0.16
42 0.16
43 0.19
44 0.2
45 0.19
46 0.25
47 0.25
48 0.26
49 0.26
50 0.25
51 0.26
52 0.3
53 0.29
54 0.24
55 0.24