Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7G4D4

Protein Details
Accession A0A0B7G4D4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-74TSGRTTFKSKKRGKPVLTKKRRKRGWINWILIQHydrophilic
NLS Segment(s)
PositionSequence
49-66KSKKRGKPVLTKKRRKRG
Subcellular Location(s) extr 9, mito 8, plas 4, nucl 1, cyto 1, cyto_nucl 1, pero 1, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MNAVCRAVQFVSTICIFLRLTIIRRKLGTFVLNSGNGLFQYTSGRTTFKSKKRGKPVLTKKRRKRGWINWILIQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.13
4 0.12
5 0.15
6 0.14
7 0.18
8 0.25
9 0.28
10 0.28
11 0.3
12 0.3
13 0.28
14 0.29
15 0.28
16 0.22
17 0.21
18 0.21
19 0.2
20 0.19
21 0.18
22 0.15
23 0.11
24 0.11
25 0.08
26 0.05
27 0.07
28 0.07
29 0.09
30 0.09
31 0.11
32 0.11
33 0.2
34 0.28
35 0.34
36 0.44
37 0.52
38 0.61
39 0.71
40 0.8
41 0.79
42 0.81
43 0.85
44 0.86
45 0.88
46 0.9
47 0.89
48 0.91
49 0.91
50 0.9
51 0.9
52 0.89
53 0.89
54 0.89
55 0.84