Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FMQ9

Protein Details
Accession A0A0B7FMQ9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSMRSKSKRAFRRTKREEGVYAHydrophilic
NLS Segment(s)
PositionSequence
7-17SKSKRAFRRTK
87-136KISTSGPRGSRREEWRKSKGLPARSKGGNRMNKHGVIASSKRSGRTKRRR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSMRSKSKRAFRRTKREEGVYAAVHAARLERLSSKLAAKVSADKDGDQNMNQGEDAEGEQVEDIGEDTAMSGEADEGEGSTAPKKISTSGPRGSRREEWRKSKGLPARSKGGNRMNKHGVIASSKRSGRTKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.89
4 0.86
5 0.83
6 0.75
7 0.69
8 0.64
9 0.53
10 0.46
11 0.36
12 0.29
13 0.23
14 0.19
15 0.14
16 0.09
17 0.09
18 0.09
19 0.1
20 0.12
21 0.14
22 0.16
23 0.17
24 0.2
25 0.2
26 0.2
27 0.19
28 0.24
29 0.23
30 0.27
31 0.26
32 0.23
33 0.24
34 0.26
35 0.26
36 0.2
37 0.2
38 0.15
39 0.15
40 0.14
41 0.12
42 0.09
43 0.08
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.02
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.02
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.07
71 0.07
72 0.08
73 0.08
74 0.1
75 0.18
76 0.24
77 0.3
78 0.36
79 0.44
80 0.51
81 0.54
82 0.57
83 0.58
84 0.61
85 0.65
86 0.67
87 0.68
88 0.68
89 0.71
90 0.68
91 0.69
92 0.66
93 0.66
94 0.66
95 0.62
96 0.61
97 0.62
98 0.63
99 0.63
100 0.66
101 0.65
102 0.6
103 0.64
104 0.62
105 0.57
106 0.55
107 0.49
108 0.41
109 0.4
110 0.4
111 0.37
112 0.38
113 0.4
114 0.44
115 0.5
116 0.57