Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A1B4

Protein Details
Accession E5A1B4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ATHHARHPSHHSKKPVPAHARPSKPABasic
NLS Segment(s)
PositionSequence
12-30HSKKPVPAHARPSKPAPLS
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024368  Ecl1/2/3  
Pfam View protein in Pfam  
PF12855  Ecl1  
Amino Acid Sequences MATHHARHPSHHSKKPVPAHARPSKPAPLSKRSLSYNKSSHKAAHSRDLEVANDEEDSMAVSFLNYCTVCEKQIIVPSNTVLYCSESCRKTDAEKSLTYSCDYYSPPMTPFGTYSFEDLTFRDIVPQRSPTQSDSKRSSMAFSDISSDDNLHSDNEKSLRSNSEASRYLRKFQSINHTSETVRPCRPRYNRASASQISFPVAPSLSHTPTSSVSYSLPYTPANFRPLPPRTNPHNSSYGAKSIDLVTPLTAPSSPKQYTHKTPPIMKTSTSTIEGEIVYAKSPVPSPSTASGSLGQLLNSTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.82
4 0.8
5 0.78
6 0.81
7 0.81
8 0.8
9 0.76
10 0.73
11 0.71
12 0.67
13 0.68
14 0.65
15 0.63
16 0.62
17 0.63
18 0.62
19 0.61
20 0.64
21 0.6
22 0.61
23 0.62
24 0.63
25 0.62
26 0.58
27 0.56
28 0.56
29 0.6
30 0.56
31 0.57
32 0.52
33 0.5
34 0.52
35 0.49
36 0.41
37 0.35
38 0.31
39 0.22
40 0.19
41 0.16
42 0.11
43 0.09
44 0.09
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.06
51 0.1
52 0.09
53 0.09
54 0.12
55 0.14
56 0.15
57 0.15
58 0.16
59 0.16
60 0.22
61 0.26
62 0.25
63 0.25
64 0.24
65 0.26
66 0.25
67 0.23
68 0.17
69 0.16
70 0.15
71 0.19
72 0.25
73 0.23
74 0.24
75 0.26
76 0.27
77 0.28
78 0.34
79 0.37
80 0.35
81 0.35
82 0.39
83 0.39
84 0.38
85 0.35
86 0.29
87 0.22
88 0.2
89 0.19
90 0.17
91 0.16
92 0.16
93 0.16
94 0.18
95 0.18
96 0.16
97 0.16
98 0.16
99 0.18
100 0.17
101 0.18
102 0.16
103 0.16
104 0.16
105 0.15
106 0.15
107 0.12
108 0.12
109 0.15
110 0.17
111 0.19
112 0.21
113 0.25
114 0.24
115 0.26
116 0.28
117 0.25
118 0.33
119 0.35
120 0.38
121 0.4
122 0.4
123 0.4
124 0.38
125 0.37
126 0.28
127 0.26
128 0.2
129 0.15
130 0.16
131 0.13
132 0.14
133 0.13
134 0.12
135 0.1
136 0.09
137 0.09
138 0.07
139 0.08
140 0.07
141 0.09
142 0.1
143 0.1
144 0.11
145 0.12
146 0.14
147 0.15
148 0.19
149 0.18
150 0.22
151 0.27
152 0.28
153 0.36
154 0.36
155 0.38
156 0.36
157 0.37
158 0.32
159 0.31
160 0.4
161 0.35
162 0.36
163 0.34
164 0.34
165 0.32
166 0.37
167 0.37
168 0.31
169 0.32
170 0.34
171 0.35
172 0.43
173 0.49
174 0.52
175 0.56
176 0.61
177 0.61
178 0.61
179 0.64
180 0.57
181 0.55
182 0.47
183 0.4
184 0.31
185 0.26
186 0.22
187 0.16
188 0.14
189 0.11
190 0.13
191 0.17
192 0.17
193 0.18
194 0.18
195 0.19
196 0.2
197 0.23
198 0.2
199 0.16
200 0.15
201 0.16
202 0.17
203 0.16
204 0.16
205 0.14
206 0.16
207 0.19
208 0.22
209 0.25
210 0.25
211 0.26
212 0.34
213 0.38
214 0.4
215 0.42
216 0.46
217 0.49
218 0.57
219 0.59
220 0.55
221 0.55
222 0.52
223 0.51
224 0.46
225 0.43
226 0.34
227 0.31
228 0.27
229 0.23
230 0.23
231 0.2
232 0.17
233 0.13
234 0.12
235 0.12
236 0.12
237 0.11
238 0.12
239 0.14
240 0.21
241 0.22
242 0.26
243 0.33
244 0.39
245 0.47
246 0.55
247 0.61
248 0.61
249 0.68
250 0.71
251 0.72
252 0.67
253 0.6
254 0.53
255 0.49
256 0.46
257 0.41
258 0.34
259 0.27
260 0.26
261 0.24
262 0.21
263 0.18
264 0.15
265 0.12
266 0.12
267 0.12
268 0.11
269 0.13
270 0.15
271 0.17
272 0.18
273 0.22
274 0.26
275 0.31
276 0.3
277 0.31
278 0.31
279 0.28
280 0.3
281 0.26
282 0.21
283 0.17