Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FSX5

Protein Details
Accession A0A0B7FSX5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-126LPSPRPSPRRERPYEKHGLMBasic
447-469ISVSPKWKVWRWRRDSVDSRSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 2, nucl 1, cyto 1, cyto_nucl 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR032816  SNARE_assoc  
IPR045014  TM41A/B  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09335  SNARE_assoc  
Amino Acid Sequences MTRWQLGLRRHTIGSNRDHGLAPSSGPSHLSARYSLSMATLSPPQPNRARSSSIVQPLTIDSLRRTPGAAQCSLPSDAPPTPITPSNQCELPNTPLGQLVTMSFNMLPSPRPSPRRERPYEKHGLMTPPSSHESSPRPSFSSMFTRPPQTQCLPTPALSPKSLSYPTISVPRRTYLAPLVLLTSCFVMSLIPIFFALRSLPVTSLKTFPRTLNDIQALGKELQAYSSGSSAGMAHVMGVMCCLAIWEHAWSVPGSVVINVLAGALISPLWATLLMTALTSAGSLFATLLAAPLSPLVQRFVPKALDVVSIALQGSGNQKPGKRTPTWVRLVVMRLIGVVPWSGINIACGVCRVSFVDCAIGAFIGTLPWTAVTCQTGDILQTLAVGSTSGSPQTLSSLLGSPSIVFKLVVLSLLSLGPVLYRNKLSELLGGSNSPAEKLTLSEKEPISVSPKWKVWRWRRDSVDSRSTSPERRLEEDLDEKALLDGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.49
4 0.47
5 0.46
6 0.41
7 0.38
8 0.32
9 0.25
10 0.22
11 0.21
12 0.19
13 0.2
14 0.21
15 0.2
16 0.22
17 0.22
18 0.2
19 0.23
20 0.24
21 0.24
22 0.21
23 0.19
24 0.17
25 0.16
26 0.17
27 0.19
28 0.19
29 0.25
30 0.27
31 0.33
32 0.4
33 0.44
34 0.48
35 0.47
36 0.5
37 0.47
38 0.5
39 0.51
40 0.53
41 0.5
42 0.43
43 0.39
44 0.35
45 0.36
46 0.32
47 0.25
48 0.19
49 0.23
50 0.25
51 0.24
52 0.24
53 0.24
54 0.29
55 0.33
56 0.32
57 0.29
58 0.28
59 0.32
60 0.32
61 0.27
62 0.22
63 0.21
64 0.2
65 0.22
66 0.22
67 0.19
68 0.21
69 0.25
70 0.28
71 0.29
72 0.31
73 0.31
74 0.32
75 0.32
76 0.32
77 0.32
78 0.33
79 0.31
80 0.29
81 0.27
82 0.27
83 0.26
84 0.23
85 0.19
86 0.16
87 0.13
88 0.12
89 0.13
90 0.1
91 0.1
92 0.11
93 0.11
94 0.12
95 0.13
96 0.2
97 0.26
98 0.32
99 0.38
100 0.48
101 0.57
102 0.66
103 0.72
104 0.75
105 0.75
106 0.79
107 0.83
108 0.74
109 0.68
110 0.61
111 0.57
112 0.49
113 0.46
114 0.37
115 0.31
116 0.33
117 0.3
118 0.27
119 0.26
120 0.29
121 0.32
122 0.36
123 0.35
124 0.34
125 0.34
126 0.35
127 0.34
128 0.38
129 0.35
130 0.36
131 0.36
132 0.39
133 0.41
134 0.43
135 0.45
136 0.39
137 0.4
138 0.36
139 0.4
140 0.37
141 0.34
142 0.35
143 0.34
144 0.34
145 0.3
146 0.29
147 0.24
148 0.26
149 0.26
150 0.22
151 0.2
152 0.18
153 0.19
154 0.27
155 0.28
156 0.28
157 0.29
158 0.3
159 0.29
160 0.28
161 0.29
162 0.23
163 0.23
164 0.2
165 0.18
166 0.18
167 0.16
168 0.16
169 0.13
170 0.1
171 0.07
172 0.06
173 0.06
174 0.04
175 0.04
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.05
185 0.06
186 0.07
187 0.08
188 0.1
189 0.13
190 0.14
191 0.17
192 0.18
193 0.21
194 0.22
195 0.22
196 0.24
197 0.27
198 0.27
199 0.28
200 0.28
201 0.25
202 0.24
203 0.23
204 0.21
205 0.17
206 0.16
207 0.1
208 0.09
209 0.08
210 0.09
211 0.09
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.03
228 0.03
229 0.03
230 0.02
231 0.03
232 0.03
233 0.04
234 0.04
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.03
249 0.03
250 0.02
251 0.02
252 0.02
253 0.02
254 0.02
255 0.02
256 0.02
257 0.02
258 0.02
259 0.03
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.03
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.04
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.05
283 0.06
284 0.08
285 0.09
286 0.11
287 0.13
288 0.13
289 0.13
290 0.13
291 0.13
292 0.13
293 0.12
294 0.12
295 0.1
296 0.09
297 0.09
298 0.08
299 0.07
300 0.07
301 0.11
302 0.11
303 0.15
304 0.17
305 0.19
306 0.24
307 0.3
308 0.35
309 0.33
310 0.4
311 0.46
312 0.52
313 0.56
314 0.54
315 0.49
316 0.46
317 0.46
318 0.4
319 0.31
320 0.22
321 0.17
322 0.14
323 0.12
324 0.1
325 0.07
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.06
333 0.06
334 0.06
335 0.07
336 0.08
337 0.07
338 0.08
339 0.09
340 0.09
341 0.1
342 0.11
343 0.12
344 0.1
345 0.11
346 0.1
347 0.09
348 0.07
349 0.06
350 0.05
351 0.04
352 0.04
353 0.04
354 0.04
355 0.04
356 0.05
357 0.05
358 0.07
359 0.08
360 0.08
361 0.09
362 0.1
363 0.09
364 0.1
365 0.1
366 0.08
367 0.07
368 0.07
369 0.06
370 0.06
371 0.05
372 0.05
373 0.05
374 0.06
375 0.06
376 0.07
377 0.07
378 0.07
379 0.07
380 0.1
381 0.1
382 0.1
383 0.1
384 0.12
385 0.13
386 0.13
387 0.13
388 0.11
389 0.12
390 0.12
391 0.11
392 0.09
393 0.08
394 0.09
395 0.1
396 0.1
397 0.09
398 0.08
399 0.09
400 0.09
401 0.09
402 0.07
403 0.06
404 0.06
405 0.1
406 0.12
407 0.14
408 0.16
409 0.18
410 0.21
411 0.23
412 0.23
413 0.23
414 0.24
415 0.24
416 0.23
417 0.22
418 0.2
419 0.21
420 0.2
421 0.16
422 0.14
423 0.11
424 0.1
425 0.12
426 0.18
427 0.2
428 0.22
429 0.29
430 0.29
431 0.3
432 0.3
433 0.3
434 0.3
435 0.31
436 0.34
437 0.34
438 0.4
439 0.44
440 0.51
441 0.59
442 0.64
443 0.7
444 0.73
445 0.76
446 0.78
447 0.82
448 0.84
449 0.82
450 0.82
451 0.75
452 0.71
453 0.69
454 0.66
455 0.62
456 0.6
457 0.58
458 0.53
459 0.54
460 0.55
461 0.5
462 0.52
463 0.52
464 0.47
465 0.43
466 0.37
467 0.33