Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FBS8

Protein Details
Accession A0A0B7FBS8   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36AGTSCLTCKLRHKRCDKRQPECERCVKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPRKLPGPAGTSCLTCKLRHKRCDKRQPECERCVKGGYDCLGYNHIRPTSRHRQLFRDTIYRRSFRAFKYHAFFIFRAYPYLRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.37
4 0.44
5 0.52
6 0.59
7 0.69
8 0.72
9 0.81
10 0.9
11 0.9
12 0.89
13 0.9
14 0.91
15 0.89
16 0.85
17 0.82
18 0.75
19 0.66
20 0.58
21 0.48
22 0.38
23 0.34
24 0.27
25 0.21
26 0.18
27 0.17
28 0.18
29 0.17
30 0.17
31 0.17
32 0.18
33 0.17
34 0.19
35 0.27
36 0.34
37 0.42
38 0.48
39 0.48
40 0.52
41 0.57
42 0.62
43 0.58
44 0.57
45 0.51
46 0.53
47 0.57
48 0.53
49 0.49
50 0.48
51 0.48
52 0.41
53 0.49
54 0.44
55 0.45
56 0.48
57 0.52
58 0.49
59 0.49
60 0.46
61 0.41
62 0.44
63 0.37
64 0.36