Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A9W5

Protein Details
Accession E5A9W5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
218-243TNSSNQAQGKRPKNRGERPHKVLACKHydrophilic
NLS Segment(s)
PositionSequence
229-232PKNR
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF18345  zf_CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MVFYSNPSDIPPSPREPPEVMEQDAAAATVVHFGPPPEKILKRYPQPTQPAPVPDLSRLEGIIASLSNASSGANPIPFTTPTAAPQETYAPPPPTGPTPDLAALLASLGQATSTPTPVQAPVQQQTAPPPFDYASLVATMQAQAANGMSLPPPPPGPMPFAFPFGVQHGMADASTYQAAMQAQYGQQDQYGQQDQYGQQDQYSQQANGGTKRARDDGTNSSNQAQGKRPKNRGERPHKVLACKFYQKGTCNKGDNCTYIHDNNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.41
4 0.42
5 0.45
6 0.44
7 0.4
8 0.35
9 0.32
10 0.28
11 0.25
12 0.22
13 0.13
14 0.08
15 0.06
16 0.08
17 0.08
18 0.07
19 0.08
20 0.09
21 0.11
22 0.12
23 0.16
24 0.2
25 0.23
26 0.28
27 0.37
28 0.45
29 0.51
30 0.57
31 0.61
32 0.62
33 0.68
34 0.67
35 0.65
36 0.61
37 0.56
38 0.52
39 0.49
40 0.42
41 0.37
42 0.35
43 0.3
44 0.25
45 0.21
46 0.19
47 0.15
48 0.13
49 0.1
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.12
65 0.13
66 0.15
67 0.14
68 0.16
69 0.21
70 0.2
71 0.18
72 0.19
73 0.21
74 0.19
75 0.22
76 0.25
77 0.22
78 0.22
79 0.22
80 0.23
81 0.21
82 0.24
83 0.21
84 0.17
85 0.17
86 0.17
87 0.17
88 0.15
89 0.12
90 0.09
91 0.07
92 0.06
93 0.04
94 0.03
95 0.03
96 0.02
97 0.03
98 0.04
99 0.05
100 0.06
101 0.06
102 0.07
103 0.08
104 0.08
105 0.1
106 0.12
107 0.15
108 0.16
109 0.18
110 0.18
111 0.18
112 0.23
113 0.25
114 0.22
115 0.18
116 0.18
117 0.16
118 0.16
119 0.17
120 0.12
121 0.09
122 0.08
123 0.08
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.06
139 0.07
140 0.08
141 0.1
142 0.11
143 0.15
144 0.15
145 0.19
146 0.19
147 0.22
148 0.21
149 0.2
150 0.2
151 0.17
152 0.19
153 0.13
154 0.12
155 0.09
156 0.09
157 0.09
158 0.08
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.07
168 0.07
169 0.08
170 0.1
171 0.11
172 0.09
173 0.1
174 0.11
175 0.11
176 0.15
177 0.18
178 0.16
179 0.16
180 0.19
181 0.2
182 0.24
183 0.27
184 0.22
185 0.18
186 0.22
187 0.22
188 0.24
189 0.26
190 0.2
191 0.18
192 0.22
193 0.24
194 0.24
195 0.29
196 0.27
197 0.26
198 0.29
199 0.31
200 0.28
201 0.28
202 0.31
203 0.34
204 0.38
205 0.4
206 0.39
207 0.37
208 0.39
209 0.39
210 0.38
211 0.37
212 0.4
213 0.46
214 0.54
215 0.61
216 0.67
217 0.76
218 0.82
219 0.85
220 0.86
221 0.87
222 0.84
223 0.86
224 0.81
225 0.79
226 0.75
227 0.71
228 0.69
229 0.66
230 0.61
231 0.58
232 0.6
233 0.58
234 0.61
235 0.62
236 0.62
237 0.61
238 0.62
239 0.62
240 0.6
241 0.57
242 0.5
243 0.48
244 0.46