Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5C0B6

Protein Details
Accession M5C0B6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
287-317TSYRDGSRSRSRERRSRSPVGRRRGGRYERNBasic
NLS Segment(s)
PositionSequence
218-316PGGHWRGGGGGGGRGRPAGLVKGGGHLAFGRDRAPGRDTSPPRNRDGPAPDRRGGGYGRRPSPDMTRGGTSYRDGSRSRSRERRSRSPVGRRRGGRYER
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MTTEIEKIPVDRTKKPPFLLRTFVRSGGFHPETAFDNGRVPTLDEHAVHVWSDSTLIDIVRALRAQTPSPSLPAGAFRNPSTRYSFRVVYYDRGNVASRDLGQVGPRELNDISGLYPSSGGQTPTPPTEPTDLPADSAMDADDDSPRKDRDDEDVLTAGATTRGGSRSKSGSRTLDELRVKPGDWLSVSLTLPASAKPVVGPAGLAIRGADREREGEPGGHWRGGGGGGGRGRPAGLVKGGGHLAFGRDRAPGRDTSPPRNRDGPAPDRRGGGYGRRPSPDMTRGGTSYRDGSRSRSRERRSRSPVGRRRGGRYERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.66
4 0.68
5 0.7
6 0.7
7 0.66
8 0.63
9 0.6
10 0.59
11 0.53
12 0.45
13 0.4
14 0.41
15 0.38
16 0.31
17 0.28
18 0.26
19 0.27
20 0.31
21 0.31
22 0.22
23 0.24
24 0.24
25 0.24
26 0.23
27 0.21
28 0.18
29 0.19
30 0.22
31 0.18
32 0.21
33 0.21
34 0.21
35 0.19
36 0.18
37 0.14
38 0.11
39 0.11
40 0.08
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.1
48 0.11
49 0.1
50 0.13
51 0.16
52 0.17
53 0.19
54 0.23
55 0.23
56 0.24
57 0.24
58 0.2
59 0.19
60 0.22
61 0.23
62 0.21
63 0.23
64 0.22
65 0.28
66 0.29
67 0.32
68 0.34
69 0.33
70 0.34
71 0.36
72 0.37
73 0.33
74 0.37
75 0.37
76 0.34
77 0.35
78 0.33
79 0.29
80 0.29
81 0.28
82 0.22
83 0.22
84 0.19
85 0.16
86 0.15
87 0.14
88 0.13
89 0.13
90 0.15
91 0.15
92 0.14
93 0.14
94 0.15
95 0.14
96 0.14
97 0.12
98 0.11
99 0.1
100 0.09
101 0.09
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.09
108 0.09
109 0.11
110 0.13
111 0.15
112 0.17
113 0.16
114 0.16
115 0.19
116 0.19
117 0.18
118 0.2
119 0.18
120 0.16
121 0.16
122 0.14
123 0.11
124 0.11
125 0.09
126 0.05
127 0.05
128 0.05
129 0.07
130 0.07
131 0.08
132 0.11
133 0.11
134 0.12
135 0.14
136 0.14
137 0.17
138 0.22
139 0.22
140 0.21
141 0.21
142 0.2
143 0.19
144 0.17
145 0.12
146 0.07
147 0.06
148 0.04
149 0.04
150 0.07
151 0.08
152 0.08
153 0.11
154 0.16
155 0.19
156 0.22
157 0.26
158 0.27
159 0.28
160 0.31
161 0.31
162 0.34
163 0.34
164 0.31
165 0.31
166 0.29
167 0.27
168 0.25
169 0.23
170 0.17
171 0.14
172 0.15
173 0.13
174 0.15
175 0.15
176 0.14
177 0.13
178 0.12
179 0.12
180 0.1
181 0.11
182 0.08
183 0.08
184 0.07
185 0.08
186 0.08
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.07
193 0.06
194 0.06
195 0.08
196 0.08
197 0.09
198 0.08
199 0.1
200 0.11
201 0.14
202 0.14
203 0.14
204 0.14
205 0.21
206 0.22
207 0.2
208 0.19
209 0.17
210 0.16
211 0.16
212 0.16
213 0.08
214 0.1
215 0.11
216 0.11
217 0.12
218 0.11
219 0.11
220 0.1
221 0.11
222 0.09
223 0.09
224 0.11
225 0.11
226 0.13
227 0.14
228 0.13
229 0.13
230 0.11
231 0.12
232 0.11
233 0.12
234 0.11
235 0.13
236 0.15
237 0.17
238 0.2
239 0.2
240 0.23
241 0.32
242 0.37
243 0.44
244 0.53
245 0.54
246 0.57
247 0.6
248 0.58
249 0.55
250 0.59
251 0.58
252 0.58
253 0.61
254 0.58
255 0.54
256 0.53
257 0.48
258 0.43
259 0.42
260 0.41
261 0.43
262 0.47
263 0.48
264 0.49
265 0.49
266 0.53
267 0.51
268 0.46
269 0.41
270 0.39
271 0.38
272 0.39
273 0.38
274 0.33
275 0.33
276 0.32
277 0.33
278 0.3
279 0.36
280 0.44
281 0.49
282 0.57
283 0.62
284 0.67
285 0.72
286 0.8
287 0.84
288 0.82
289 0.85
290 0.86
291 0.87
292 0.87
293 0.87
294 0.88
295 0.83
296 0.82
297 0.82