Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FML9

Protein Details
Accession A0A0B7FML9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-70GHALGRAPRKNRKKKIKKWIALVYNGHydrophilic
NLS Segment(s)
PositionSequence
45-62GHALGRAPRKNRKKKIKK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MGGSRRKYVLSILHIKRDTAPRAPEAGTLFDRRKPIGRAAVQHFGHALGRAPRKNRKKKIKKWIALVYNGTSSPTNTAQEREKKVGLGDKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.5
4 0.5
5 0.47
6 0.42
7 0.42
8 0.35
9 0.38
10 0.38
11 0.35
12 0.29
13 0.29
14 0.25
15 0.27
16 0.26
17 0.27
18 0.28
19 0.27
20 0.29
21 0.28
22 0.3
23 0.32
24 0.34
25 0.36
26 0.39
27 0.46
28 0.42
29 0.4
30 0.35
31 0.28
32 0.25
33 0.19
34 0.15
35 0.13
36 0.18
37 0.21
38 0.27
39 0.36
40 0.47
41 0.57
42 0.66
43 0.72
44 0.78
45 0.85
46 0.91
47 0.92
48 0.89
49 0.87
50 0.86
51 0.8
52 0.74
53 0.67
54 0.58
55 0.49
56 0.42
57 0.35
58 0.26
59 0.21
60 0.19
61 0.19
62 0.19
63 0.19
64 0.23
65 0.29
66 0.38
67 0.44
68 0.45
69 0.44
70 0.42
71 0.45