Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FDX3

Protein Details
Accession A0A0B7FDX3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYMGRLRRSRVHKAQRDVHRASRHydrophilic
75-100VALRSHWKSKVHKRRCKQLKEPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MYMGRLRRSRVHKAQRDVHRASRTRARTRDLDQIQLHDLDPAVRAKLEAQPIDVEKPGLAQHYCVECAKYYETDVALRSHWKSKVHKRRCKQLKEPAYTIEEAERAGGLGREVRKRPSADTPTTAPDMELTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.81
5 0.79
6 0.77
7 0.72
8 0.69
9 0.69
10 0.67
11 0.68
12 0.67
13 0.64
14 0.6
15 0.61
16 0.65
17 0.58
18 0.57
19 0.49
20 0.46
21 0.42
22 0.37
23 0.33
24 0.23
25 0.2
26 0.12
27 0.13
28 0.11
29 0.09
30 0.08
31 0.08
32 0.09
33 0.13
34 0.17
35 0.15
36 0.15
37 0.17
38 0.18
39 0.19
40 0.18
41 0.14
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.08
48 0.11
49 0.12
50 0.13
51 0.12
52 0.13
53 0.11
54 0.12
55 0.13
56 0.11
57 0.1
58 0.1
59 0.11
60 0.11
61 0.12
62 0.11
63 0.11
64 0.13
65 0.14
66 0.18
67 0.21
68 0.26
69 0.34
70 0.44
71 0.55
72 0.63
73 0.71
74 0.74
75 0.82
76 0.86
77 0.87
78 0.85
79 0.85
80 0.84
81 0.81
82 0.77
83 0.7
84 0.63
85 0.54
86 0.45
87 0.35
88 0.26
89 0.18
90 0.16
91 0.12
92 0.08
93 0.08
94 0.07
95 0.06
96 0.11
97 0.16
98 0.23
99 0.26
100 0.31
101 0.37
102 0.39
103 0.43
104 0.48
105 0.52
106 0.5
107 0.53
108 0.52
109 0.5
110 0.51
111 0.46
112 0.36