Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7G3Q7

Protein Details
Accession A0A0B7G3Q7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
354-380IVTRGAGFRKEKNKKKRGSYRGGEITMHydrophilic
NLS Segment(s)
PositionSequence
360-371GFRKEKNKKKRG
Subcellular Location(s) nucl 13.5, cyto_nucl 11.833, mito_nucl 10.166, cyto 8, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MSRLPDIYRAVHAFLLEQGHTKAAQAVKKAALPVVDVDTPSAAASKSLVELYSSQVPAVDKSVDHSSSSDDSSSSSSEDESVASPKKVPVVNGKFSGTTNGAAKAPAKASNGSEDSSSSEDDSSSSNESSDSDSSDSSDSGSDSSSDEEENKADSSAKPVAKAAPKPAVDSKTKPVANGVTKSAANGKSKSKDSGSSSDSSDSSSSEESDSSSGSESSNSESESESESESESESDSESEPENQPAAKKRKVDATSSVSVPVPATTTTKTKITTVATTPESVTLTKSTTTSTTTSANDKNDKNGKQKGTRKPVVPFSRIKADDVVYADPRLMNNSFDSKGGTNNDYGERASRDLIVTRGAGFRKEKNKKKRGSYRGGEITMQSHSIKFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.18
4 0.18
5 0.17
6 0.18
7 0.18
8 0.18
9 0.2
10 0.22
11 0.25
12 0.26
13 0.3
14 0.31
15 0.34
16 0.34
17 0.31
18 0.26
19 0.24
20 0.22
21 0.22
22 0.2
23 0.18
24 0.17
25 0.16
26 0.15
27 0.14
28 0.13
29 0.08
30 0.07
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.15
39 0.2
40 0.2
41 0.18
42 0.19
43 0.2
44 0.2
45 0.21
46 0.18
47 0.12
48 0.16
49 0.22
50 0.21
51 0.21
52 0.2
53 0.22
54 0.23
55 0.24
56 0.21
57 0.15
58 0.16
59 0.16
60 0.17
61 0.14
62 0.12
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.14
69 0.16
70 0.16
71 0.17
72 0.18
73 0.23
74 0.23
75 0.25
76 0.31
77 0.36
78 0.41
79 0.42
80 0.43
81 0.39
82 0.37
83 0.38
84 0.29
85 0.24
86 0.2
87 0.19
88 0.18
89 0.17
90 0.18
91 0.17
92 0.17
93 0.19
94 0.19
95 0.19
96 0.2
97 0.24
98 0.25
99 0.23
100 0.21
101 0.18
102 0.19
103 0.18
104 0.18
105 0.13
106 0.11
107 0.11
108 0.11
109 0.11
110 0.11
111 0.12
112 0.11
113 0.11
114 0.11
115 0.11
116 0.14
117 0.13
118 0.13
119 0.11
120 0.11
121 0.13
122 0.13
123 0.12
124 0.1
125 0.1
126 0.08
127 0.07
128 0.08
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.09
137 0.1
138 0.1
139 0.09
140 0.1
141 0.09
142 0.13
143 0.19
144 0.19
145 0.18
146 0.19
147 0.23
148 0.27
149 0.29
150 0.29
151 0.3
152 0.3
153 0.32
154 0.36
155 0.36
156 0.34
157 0.35
158 0.35
159 0.36
160 0.36
161 0.33
162 0.31
163 0.32
164 0.32
165 0.31
166 0.28
167 0.23
168 0.22
169 0.22
170 0.25
171 0.24
172 0.23
173 0.24
174 0.26
175 0.28
176 0.3
177 0.32
178 0.28
179 0.28
180 0.29
181 0.32
182 0.3
183 0.27
184 0.27
185 0.26
186 0.24
187 0.21
188 0.17
189 0.13
190 0.11
191 0.1
192 0.09
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.07
203 0.07
204 0.09
205 0.09
206 0.09
207 0.09
208 0.09
209 0.1
210 0.12
211 0.12
212 0.1
213 0.1
214 0.1
215 0.09
216 0.1
217 0.09
218 0.07
219 0.06
220 0.06
221 0.07
222 0.07
223 0.08
224 0.08
225 0.11
226 0.12
227 0.12
228 0.13
229 0.13
230 0.15
231 0.23
232 0.3
233 0.32
234 0.34
235 0.36
236 0.44
237 0.46
238 0.47
239 0.45
240 0.45
241 0.43
242 0.4
243 0.4
244 0.3
245 0.28
246 0.24
247 0.17
248 0.11
249 0.09
250 0.11
251 0.11
252 0.15
253 0.16
254 0.19
255 0.2
256 0.2
257 0.23
258 0.23
259 0.25
260 0.24
261 0.27
262 0.26
263 0.26
264 0.25
265 0.23
266 0.21
267 0.18
268 0.17
269 0.13
270 0.13
271 0.13
272 0.13
273 0.13
274 0.13
275 0.16
276 0.16
277 0.17
278 0.19
279 0.2
280 0.25
281 0.28
282 0.32
283 0.37
284 0.36
285 0.43
286 0.48
287 0.52
288 0.55
289 0.59
290 0.61
291 0.64
292 0.73
293 0.75
294 0.77
295 0.77
296 0.75
297 0.73
298 0.75
299 0.74
300 0.7
301 0.65
302 0.6
303 0.63
304 0.58
305 0.53
306 0.46
307 0.39
308 0.36
309 0.34
310 0.32
311 0.24
312 0.23
313 0.22
314 0.2
315 0.19
316 0.2
317 0.18
318 0.16
319 0.17
320 0.22
321 0.22
322 0.21
323 0.24
324 0.21
325 0.25
326 0.28
327 0.26
328 0.23
329 0.26
330 0.28
331 0.26
332 0.26
333 0.25
334 0.24
335 0.23
336 0.23
337 0.22
338 0.21
339 0.22
340 0.22
341 0.21
342 0.19
343 0.19
344 0.23
345 0.22
346 0.26
347 0.29
348 0.36
349 0.44
350 0.54
351 0.63
352 0.69
353 0.78
354 0.82
355 0.88
356 0.91
357 0.91
358 0.91
359 0.88
360 0.87
361 0.86
362 0.8
363 0.71
364 0.62
365 0.53
366 0.45
367 0.4
368 0.31