Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FAX9

Protein Details
Accession A0A0B7FAX9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-28NEVVRRSPRSRSRKPALTRSRGVHydrophilic
NLS Segment(s)
PositionSequence
12-22SPRSRSRKPAL
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MINTHNEVVRRSPRSRSRKPALTRSRGVRVAPATRHMTISFHFISYYIHKQRSLSIYTLALPVLSLQNSFEYEKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.75
4 0.75
5 0.78
6 0.82
7 0.83
8 0.83
9 0.81
10 0.77
11 0.73
12 0.7
13 0.64
14 0.56
15 0.5
16 0.44
17 0.41
18 0.36
19 0.35
20 0.32
21 0.3
22 0.3
23 0.26
24 0.23
25 0.18
26 0.21
27 0.17
28 0.13
29 0.12
30 0.11
31 0.13
32 0.16
33 0.24
34 0.25
35 0.27
36 0.27
37 0.28
38 0.33
39 0.35
40 0.34
41 0.27
42 0.24
43 0.23
44 0.23
45 0.23
46 0.18
47 0.14
48 0.1
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.11
55 0.14
56 0.16