Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7F5R6

Protein Details
Accession A0A0B7F5R6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-91ESVALRPKYCKRKPHRSDYRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVQNCSRAANFPGHRGARYTGTDNSPIEASDWQAHKLDRLKVPTPLSLQLLPHYISTPLCPTWRHHLSVVESVALRPKYCKRKPHRSDYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.39
4 0.34
5 0.35
6 0.35
7 0.3
8 0.31
9 0.34
10 0.31
11 0.3
12 0.25
13 0.22
14 0.19
15 0.15
16 0.14
17 0.15
18 0.16
19 0.16
20 0.17
21 0.17
22 0.2
23 0.25
24 0.28
25 0.27
26 0.31
27 0.31
28 0.34
29 0.36
30 0.34
31 0.31
32 0.28
33 0.26
34 0.21
35 0.2
36 0.16
37 0.16
38 0.15
39 0.13
40 0.12
41 0.11
42 0.1
43 0.11
44 0.12
45 0.12
46 0.14
47 0.15
48 0.18
49 0.26
50 0.3
51 0.31
52 0.31
53 0.34
54 0.36
55 0.4
56 0.37
57 0.3
58 0.26
59 0.24
60 0.28
61 0.25
62 0.22
63 0.22
64 0.3
65 0.39
66 0.47
67 0.57
68 0.61
69 0.71
70 0.8
71 0.86