Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FTF5

Protein Details
Accession A0A0B7FTF5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
145-168QIYDMRLTDHRRRRQQKEVDALAPHydrophilic
NLS Segment(s)
PositionSequence
80-111AKQKKKQEQAEKDKKEGEEKKDEEKKDEEKKE
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 12, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSTPFSNVYYKRAVATPRACYICSKPTTIVLSTQPVLDYIYTCNTHLSDPGFATLQAPAVSSTPSANAEEIAKIKAEWEAKQKKKQEQAEKDKKEGEEKKDEEKKDEEKKEGEKEQTLSPKPASPAPTASGSTTPKHDKYVLHRQIYDMRLTDHRRRRQQKEVDALAPKLSGAGLNVPKQIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.42
4 0.45
5 0.46
6 0.45
7 0.45
8 0.46
9 0.46
10 0.42
11 0.4
12 0.34
13 0.36
14 0.39
15 0.36
16 0.34
17 0.28
18 0.3
19 0.28
20 0.26
21 0.21
22 0.18
23 0.18
24 0.15
25 0.12
26 0.1
27 0.14
28 0.14
29 0.15
30 0.16
31 0.16
32 0.16
33 0.17
34 0.17
35 0.14
36 0.13
37 0.14
38 0.13
39 0.12
40 0.13
41 0.11
42 0.1
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.11
63 0.12
64 0.14
65 0.23
66 0.32
67 0.38
68 0.46
69 0.53
70 0.56
71 0.63
72 0.68
73 0.69
74 0.69
75 0.75
76 0.78
77 0.75
78 0.71
79 0.65
80 0.57
81 0.56
82 0.51
83 0.45
84 0.43
85 0.42
86 0.49
87 0.53
88 0.53
89 0.48
90 0.47
91 0.49
92 0.49
93 0.51
94 0.45
95 0.42
96 0.46
97 0.49
98 0.49
99 0.44
100 0.37
101 0.35
102 0.37
103 0.41
104 0.38
105 0.35
106 0.31
107 0.31
108 0.3
109 0.32
110 0.3
111 0.24
112 0.25
113 0.24
114 0.26
115 0.24
116 0.24
117 0.25
118 0.24
119 0.24
120 0.27
121 0.3
122 0.29
123 0.31
124 0.33
125 0.33
126 0.38
127 0.48
128 0.51
129 0.5
130 0.49
131 0.49
132 0.54
133 0.52
134 0.47
135 0.36
136 0.31
137 0.34
138 0.41
139 0.48
140 0.5
141 0.58
142 0.65
143 0.74
144 0.79
145 0.81
146 0.84
147 0.84
148 0.84
149 0.81
150 0.77
151 0.72
152 0.65
153 0.56
154 0.45
155 0.35
156 0.26
157 0.19
158 0.13
159 0.09
160 0.16
161 0.2
162 0.23