Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7FQF3

Protein Details
Accession A0A0B7FQF3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
6-25QTPQGPPRPRRAPPRDCDFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLSVIQTPQGPPRPRRAPPRDCDFFFFGYNLLLGHERVVEHRGPLGNRKKTKTGEQGEGQEEEHAKEYRKGDPRDCDQDFCQLGHCYDPQKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.74
4 0.75
5 0.75
6 0.8
7 0.77
8 0.71
9 0.69
10 0.61
11 0.53
12 0.44
13 0.36
14 0.27
15 0.2
16 0.17
17 0.12
18 0.1
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.11
26 0.1
27 0.09
28 0.11
29 0.13
30 0.13
31 0.22
32 0.3
33 0.36
34 0.4
35 0.43
36 0.47
37 0.48
38 0.55
39 0.56
40 0.52
41 0.5
42 0.48
43 0.49
44 0.45
45 0.43
46 0.36
47 0.28
48 0.23
49 0.19
50 0.18
51 0.16
52 0.15
53 0.19
54 0.21
55 0.28
56 0.36
57 0.4
58 0.44
59 0.5
60 0.55
61 0.6
62 0.6
63 0.57
64 0.49
65 0.53
66 0.48
67 0.41
68 0.37
69 0.3
70 0.28
71 0.28
72 0.29
73 0.25