Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7FBR4

Protein Details
Accession A0A0B7FBR4    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-35VMRGPNRPSRPKPTLRKPKQTVKEAQRHydrophilic
NLS Segment(s)
PositionSequence
14-27NRPSRPKPTLRKPK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MGQTKGDAVMRGPNRPSRPKPTLRKPKQTVKEAQRVEPDKQDGELDAEGEDKEVSIDGGDEKVKGGVRLTTKDSGLKEKAKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.58
4 0.59
5 0.65
6 0.7
7 0.76
8 0.8
9 0.83
10 0.84
11 0.88
12 0.86
13 0.87
14 0.86
15 0.83
16 0.81
17 0.78
18 0.78
19 0.69
20 0.65
21 0.63
22 0.58
23 0.52
24 0.47
25 0.4
26 0.31
27 0.29
28 0.25
29 0.17
30 0.16
31 0.13
32 0.1
33 0.07
34 0.08
35 0.07
36 0.07
37 0.07
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.06
46 0.06
47 0.06
48 0.07
49 0.09
50 0.1
51 0.1
52 0.11
53 0.14
54 0.18
55 0.22
56 0.27
57 0.28
58 0.29
59 0.33
60 0.35
61 0.38
62 0.41
63 0.42