Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5BUB9

Protein Details
Accession M5BUB9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAVKIIKKRTKPFKRHQSDRYVSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
7-50KKRTKPFKRHQSDRYVSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIIKKRTKPFKRHQSDRYVSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKLVVNNVRELELLLMHNKSFAAEIAHGVSSKNRVTILERAKALSIKVTNPAAKLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.9
4 0.9
5 0.85
6 0.82
7 0.78
8 0.7
9 0.6
10 0.56
11 0.56
12 0.53
13 0.56
14 0.57
15 0.54
16 0.53
17 0.54
18 0.57
19 0.6
20 0.61
21 0.62
22 0.65
23 0.71
24 0.79
25 0.83
26 0.76
27 0.74
28 0.71
29 0.68
30 0.68
31 0.64
32 0.64
33 0.64
34 0.66
35 0.59
36 0.52
37 0.46
38 0.38
39 0.38
40 0.33
41 0.35
42 0.4
43 0.42
44 0.42
45 0.46
46 0.47
47 0.47
48 0.46
49 0.47
50 0.45
51 0.53
52 0.55
53 0.51
54 0.47
55 0.39
56 0.37
57 0.35
58 0.32
59 0.24
60 0.25
61 0.25
62 0.26
63 0.26
64 0.23
65 0.17
66 0.12
67 0.12
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.08
77 0.07
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.12
84 0.14
85 0.14
86 0.15
87 0.14
88 0.15
89 0.19
90 0.27
91 0.32
92 0.34
93 0.35
94 0.35
95 0.36
96 0.36
97 0.33
98 0.31
99 0.26
100 0.22
101 0.27
102 0.31
103 0.32
104 0.33
105 0.38
106 0.34