Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BHL0

Protein Details
Accession Q6BHL0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-84NSPKSKIRKIKHQKKDGERKIKTERRKRAEIREGLBasic
NLS Segment(s)
PositionSequence
52-78PKSKIRKIKHQKKDGERKIKTERRKRA
Subcellular Location(s) mito 9, E.R. 5, golg 4, nucl 3, cyto 2, plas 2
Family & Domain DBs
KEGG dha:DEHA2G17754g  -  
Amino Acid Sequences MRYYTPIDRFLNKIKRKGFFLYSSIILLSTLYVFYTISHLPDVSKIEPENSPKSKIRKIKHQKKDGERKIKTERRKRAEIREGLVDGVGVHPANHSVSEMKAKVQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.62
4 0.63
5 0.59
6 0.52
7 0.48
8 0.43
9 0.37
10 0.33
11 0.29
12 0.23
13 0.17
14 0.13
15 0.1
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.08
23 0.08
24 0.09
25 0.09
26 0.09
27 0.09
28 0.11
29 0.14
30 0.12
31 0.13
32 0.13
33 0.14
34 0.16
35 0.21
36 0.26
37 0.25
38 0.29
39 0.31
40 0.36
41 0.42
42 0.48
43 0.48
44 0.52
45 0.61
46 0.67
47 0.73
48 0.78
49 0.79
50 0.82
51 0.89
52 0.88
53 0.88
54 0.8
55 0.77
56 0.78
57 0.78
58 0.78
59 0.77
60 0.77
61 0.74
62 0.81
63 0.8
64 0.8
65 0.82
66 0.77
67 0.7
68 0.64
69 0.58
70 0.48
71 0.4
72 0.3
73 0.2
74 0.15
75 0.13
76 0.07
77 0.06
78 0.06
79 0.08
80 0.09
81 0.09
82 0.1
83 0.1
84 0.13
85 0.21
86 0.21