Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A1W6

Protein Details
Accession E5A1W6   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-77HCTPQTQQTRLKKKNPRAQYKTHIVRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, extr 6, plas 5, pero 2, E.R. 2, golg 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MWRLIIIIIIIITSTTSIHLFFNSFSLQLLQPNPHKTNTLESKLPSFDPAHCTPQTQQTRLKKKNPRAQYKTHIVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.11
10 0.1
11 0.1
12 0.09
13 0.11
14 0.1
15 0.12
16 0.14
17 0.16
18 0.2
19 0.26
20 0.27
21 0.26
22 0.28
23 0.26
24 0.32
25 0.34
26 0.33
27 0.29
28 0.28
29 0.29
30 0.29
31 0.28
32 0.23
33 0.19
34 0.17
35 0.21
36 0.24
37 0.27
38 0.26
39 0.28
40 0.27
41 0.36
42 0.41
43 0.39
44 0.44
45 0.49
46 0.6
47 0.66
48 0.75
49 0.75
50 0.79
51 0.85
52 0.87
53 0.88
54 0.84
55 0.85
56 0.84
57 0.85