Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5AES8

Protein Details
Accession E5AES8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-58LGFLSRKKGRDRSPKAKERGVBasic
NLS Segment(s)
PositionSequence
43-58RKKGRDRSPKAKERGV
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MGGGVQVVLNETGSWTEMANQSSALVQNPPGEKPSGMLGFLSRKKGRDRSPKAKERGVLGKEGARVIISNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.09
4 0.12
5 0.13
6 0.13
7 0.12
8 0.12
9 0.12
10 0.13
11 0.11
12 0.08
13 0.09
14 0.12
15 0.14
16 0.14
17 0.14
18 0.14
19 0.13
20 0.14
21 0.15
22 0.12
23 0.11
24 0.1
25 0.11
26 0.16
27 0.18
28 0.25
29 0.23
30 0.26
31 0.32
32 0.4
33 0.48
34 0.53
35 0.61
36 0.65
37 0.74
38 0.81
39 0.81
40 0.79
41 0.72
42 0.67
43 0.67
44 0.58
45 0.51
46 0.44
47 0.42
48 0.38
49 0.36
50 0.3
51 0.21