Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A057

Protein Details
Accession E5A057    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-64VYKLHPIITKRHKPRNKILIRHLASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MRVYAAARPMEIANKGSSVLLCGLVWMREGGKEGYKVCIVYKLHPIITKRHKPRNKILIRHLASPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.14
5 0.12
6 0.11
7 0.1
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.07
14 0.06
15 0.06
16 0.08
17 0.09
18 0.1
19 0.12
20 0.12
21 0.13
22 0.14
23 0.14
24 0.12
25 0.17
26 0.17
27 0.17
28 0.24
29 0.24
30 0.26
31 0.3
32 0.31
33 0.35
34 0.44
35 0.52
36 0.55
37 0.63
38 0.68
39 0.72
40 0.81
41 0.83
42 0.82
43 0.81
44 0.81
45 0.81
46 0.78
47 0.76