Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A5C3

Protein Details
Accession E5A5C3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
133-158SSQMNGKVAKKPKKKAKAVKLTFGDEHydrophilic
NLS Segment(s)
PositionSequence
139-150KVAKKPKKKAKA
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKAKDLQFDSSQPAFLQRLRGQLQSGDSARHEQPIARNKKAKENDEDDAPTYVLEDTNQSLTKEEYEALLSGKESKEDQDATAKTESPDSAEGPAKSKDKIVQVGGSVKKRKAAKIIGDEQDADTTQHQDSSQMNGKVAKKPKKKAKAVKLTFGDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.26
4 0.25
5 0.31
6 0.26
7 0.33
8 0.35
9 0.37
10 0.34
11 0.34
12 0.35
13 0.33
14 0.31
15 0.26
16 0.25
17 0.27
18 0.27
19 0.26
20 0.24
21 0.21
22 0.28
23 0.36
24 0.42
25 0.45
26 0.5
27 0.5
28 0.6
29 0.65
30 0.63
31 0.6
32 0.58
33 0.53
34 0.51
35 0.51
36 0.42
37 0.35
38 0.3
39 0.22
40 0.16
41 0.14
42 0.09
43 0.08
44 0.07
45 0.07
46 0.1
47 0.11
48 0.11
49 0.11
50 0.12
51 0.12
52 0.12
53 0.11
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.1
66 0.11
67 0.11
68 0.15
69 0.15
70 0.17
71 0.18
72 0.18
73 0.16
74 0.16
75 0.15
76 0.11
77 0.12
78 0.1
79 0.12
80 0.14
81 0.15
82 0.16
83 0.2
84 0.2
85 0.19
86 0.2
87 0.21
88 0.22
89 0.25
90 0.24
91 0.22
92 0.22
93 0.29
94 0.33
95 0.36
96 0.37
97 0.34
98 0.38
99 0.4
100 0.41
101 0.41
102 0.43
103 0.44
104 0.48
105 0.55
106 0.52
107 0.51
108 0.48
109 0.42
110 0.36
111 0.29
112 0.22
113 0.15
114 0.14
115 0.13
116 0.13
117 0.12
118 0.14
119 0.15
120 0.21
121 0.27
122 0.26
123 0.28
124 0.33
125 0.36
126 0.42
127 0.51
128 0.54
129 0.56
130 0.65
131 0.74
132 0.79
133 0.86
134 0.89
135 0.9
136 0.91
137 0.88
138 0.88
139 0.83
140 0.77
141 0.68